6CGL


Conserved Protein Domain Family
Ribonuc_red_lgC

?
pfam02867: Ribonuc_red_lgC 
Ribonucleotide reductase, barrel domain
Statistics
?
PSSM-Id: 397137
Aligned: 73 rows
Threshold Bit Score: 434.318
Threshold Setting Gi: 81530765
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CGL_A             168 VSCfll--------evNDSL-----NDISRAidismqlsklgggvSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAF 234 
WP_012021658       194 SACfvl--------pvRDSMtspsgDGIYDTlramalvhqqgggtGFDFSELRPKGDVVASTAGVASGPVSFMKIFDVST 265  Metallos...
Q5JJ43             744 LAG-------------ENGM-----VFVHNT--------------GLNFSKLRPEGDLVGTTTGAASGPVSFMHLIDAVS 791  Thermoco...
Q5V1R5             175 SACfvd--------spGDDI-----DDIHQTakeaaqvfqsgggmGYAFWKLRPYGDPVGSTGGIASGPITFMRTYDQMC 241  Haloarcu...
Q11ZE1              91 ANCfvqpvgdaiqgvdTEGY-----PGIYEAlreaaetmrrgggvGYDFSRIRPRGSVVKGTASSASGPCSYIDVFDASC 165  Polaromo...
WP_011715030       105 VSQt-----------vKDSM-----DDILAAvheagltlkagcgiGYEFSTLRPRGAFVAGAGSSTSGPLSFMDIYDAMC 168  Magnetoc...
mgcchina:PST_0109  136 VSGs-----------iTDSM-----DDILGKvheagltlkagcgiGYEFSTLRPRGSFVSGAGAHTSGPLSFMDIFDKMC 199  Pseudomo...
Q6QGJ1             255 ASCclv--------dsTDTL-----DSIDTAehivfkmvaaragiGYHLE-SRSIADPVRNGAFPHSGKLPYYRHIDRSV 320  Escheric...
P32282             220 SSCvvi--------eaGDSL-----KSINKAsasiveyiskragiGINVGMIRAEGSKIGMGEVRHTGVIPFWKHFQTAV 286  Escheric...
jgi:Rmag_0523      223 SSCvli--------evDDDL-----DSISAGagaivkyvsqragiGINGGKIRAIGSPIRGGEAIHTGCIPFYKHFHTAV 289  Candidat...
6CGL_A             235 RYADQMGQRQGSGAAYLNIFHRDINDFLDTK-KISAd-----------------------------------------eD 272 
WP_012021658       266 DVVKQGGKRRGANMGVMHAWHADIEDFIHAKtGELK-------------------------------------------D 302  Metallos...
Q5JJ43             792 DVIKQGGVRRGANMGILEVWHPDIEKFIHAKeKNTG-------------------------------------------T 828  Thermoco...
Q5V1R5             242 ETIAQGGARRGAQMGVMRVSHPDVIQFIHAKnKDVSlaetlrlndpddfthnsfaealeearelidddgqvpkhlrnavE 321  Haloarcu...
Q11ZE1             166 KTVESAGARRGAQMGVMKISHPDILEFITAKr----------------------------------------------eV 199  Polaromo...
WP_011715030       169 RTVSSAGGRRGAQMATFDITHPDVVDFIRAKrE----------------------------------------------D 202  Magnetoc...
mgcchina:PST_0109  200 FTVSSAGGRRGAQMGTFDVGHPDVREFIRAKrE----------------------------------------------D 233  Pseudomo...
Q6QGJ1             321 KANTQQ-TRGGSATVSYPYFDPEIIQLMQVKqQRATd------------------------------------------E 357  Escheric...
P32282             287 KSCSQGGIRGGAATAYYPIWHLEVENLLVLK-NNKGv-----------------------------------------eE 324  Escheric...
jgi:Rmag_0523      290 KSCSQGGVRGGAATLFYPLWHLEVESLLVLK-NNTGt-----------------------------------------dE 327  Candidat...
6CGL_A             273 VRVKTLSIGVVIPDKFVELAREDKAAYVFY---PHTiykeygqhmdemdmn----------------------------- 320 
WP_012021658       303 VQLQNFNISVGVYDYFMEAVMKEEQVPLIT---PRktkipgtdheyyivkarnymreewvqeeilreleekgsvyldesk 379  Metallos...
Q5JJ43             829 NVLSNFNISVGLWEDFWEALKEGKRYPLIN---PRTgek----------------------------------------- 864  Thermoco...
Q5V1R5             322 GHLSNFNISVGVTDDFMEALKAGEEFTFTN---PRTgdahivteetkelyd----------------------------- 369  Haloarcu...
Q11ZE1             200 GRWNNFNVSVGIVDGFMAAVEANEMWPLVHkaePSveqqragayl----------------------------------- 244  Polaromo...
WP_011715030       203 GRLRQFNLSCLVTEQFMEAVKSDMDWELVF---PAnhyelddptveivyrhwpv------------------------te 255  Magnetoc...
mgcchina:PST_0109  234 GRLRQFNLSLLITDEFMQTVEADGEWPLIF---PVhakeaaeldladdaqviwrew--------------------pvhd 290  Pseudomo...
Q6QGJ1             358 NKIDKMDYSLSFNNLLLKRYLKNEDITLMSyfyapevheafysddeakfeeiyv-------------------aaekrva 418  Escheric...
P32282             325 NRIRHMDYGVQLNDLMMERFGKNDYITLFS---PHemggelyysyfkdqdrf---------------------------- 373  Escheric...
jgi:Rmag_0523      328 NRIRHLDYGVQFNGLMYQRFLKDDDITLFS---PHdvpglydaffanqeef----------------------------- 375  Candidat...
6CGL_A             321 -emydkfvdnprvkkeKI---NPRKLLEKLAMLRSESGYPYIMFQDNVNKVHAN--NH--ISKVKFSNL----------- 381 
WP_012021658       380 iitvdealaiaekegaVIrwvNARTLFEQIVKGAWDSGDPGLLFIDEINRRHPTwyLG----KIQATNP----------- 444  Metallos...
Q5JJ43             865 --------------vkEI---DPKSLFEELAYMAWAKADPGVVFFDVINRRNVLepAK--GEKIRATNPcvvgdtrvltp 925  Thermoco...
Q5V1R5             370 --mfglgehvevgeelSI---PAEELWDDIVEGAHENGEPGVIYLERVNKQHSFdvEEhpDHEILATNP----------- 433  Haloarcu...
Q11ZE1             245 ------resdglwvyrEV---PAAEIWDTVMKSCYDFAEPGIVFLDLMNLDNNLsyVE----TIEATNP----------- 300  Polaromo...
WP_011715030       256 gyktneqgevacrvwkSI---PARRLWDVVMSSTYDYAEPGFILIDKVNEQNNNwfCE----DIRATNP----------- 317  Magnetoc...
mgcchina:PST_0109  291 gyivrddglvackiygRV---KARHLWDMIMVSTYDYAEPGFILIDRVNQLNNNwwCE----AIRATNP----------- 352  Pseudomo...
Q6QGJ1             419 sltkidhegktvpaapKV---SAKEILDTWLRIRMETGRMYAHHIGESNRHGNF------LDPIRMTNL----------- 478  Escheric...
P32282             374 relyeaaekdpnirkkRI---KARELFELLMTERSGTARIYVQFIDNTNNYTPFirEK---APIRQSNL----------- 436  Escheric...
jgi:Rmag_0523      376 krlyeqyeqndsirkqAI---KARELFAKFMQERANTGRIYLQNVDHCNTHSAFdaKQ---APIKQSNL----------- 438  Candidat...
6CGL_A                 --------------------------------------------------------------------------------     
WP_012021658           --------------------------------------------------------------------------------      Metallos...
Q5JJ43             926 egyikaeelfslakergkkeavavegiaeegepyaysvevllpgeeevkyetvhgkalaiadpvavpayvwkvgkkkvar 1005 Thermoco...
Q5V1R5                 --------------------------------------------------------------------------------      Haloarcu...
Q11ZE1                 --------------------------------------------------------------------------------      Polaromo...
WP_011715030           --------------------------------------------------------------------------------      Magnetoc...
mgcchina:PST_0109      --------------------------------------------------------------------------------      Pseudomo...
Q6QGJ1                 --------------------------------------------------------------------------------      Escheric...
P32282                 --------------------------------------------------------------------------------      Escheric...
jgi:Rmag_0523          --------------------------------------------------------------------------------      Candidat...
6CGL_A                 --------------------------------------------------------------------------------     
WP_012021658           --------------------------------------------------------------------------------      Metallos...
Q5JJ43            1006 vrtkqgyeitatldhrlmtsegwkevgelkpgdeillprfeieedfgsesigedlafvlgwfigdgylnvndkrawfyfn 1085 Thermoco...
Q5V1R5                 --------------------------------------------------------------------------------      Haloarcu...
Q11ZE1                 --------------------------------------------------------------------------------      Polaromo...
WP_011715030           --------------------------------------------------------------------------------      Magnetoc...
mgcchina:PST_0109      --------------------------------------------------------------------------------      Pseudomo...
Q6QGJ1                 --------------------------------------------------------------------------------      Escheric...
P32282                 --------------------------------------------------------------------------------      Escheric...
jgi:Rmag_0523          --------------------------------------------------------------------------------      Candidat...
6CGL_A                 --------------------------------------------------------------------------------     
WP_012021658           --------------------------------------------------------------------------------      Metallos...
Q5JJ43            1086 aekeediawkireilakhfgikaephrygnqiklgvrgeayrwlesimgsnekrvpeiiyrlkpreiaaflrglfsadgy 1165 Thermoco...
Q5V1R5                 --------------------------------------------------------------------------------      Haloarcu...
Q11ZE1                 --------------------------------------------------------------------------------      Polaromo...
WP_011715030           --------------------------------------------------------------------------------      Magnetoc...
mgcchina:PST_0109      --------------------------------------------------------------------------------      Pseudomo...
Q6QGJ1                 --------------------------------------------------------------------------------      Escheric...
P32282                 --------------------------------------------------------------------------------      Escheric...
jgi:Rmag_0523          --------------------------------------------------------------------------------      Candidat...
6CGL_A                 --------------------------------------------------------------------------------     
WP_012021658           --------------------------------------------------------------------------------      Metallos...
Q5JJ43            1166 vdndnavrltskdrgllrdvqdllllfgilskiyerpyssefkyttkdgeertyraegyyelvianysrklfaekigfeg 1245 Thermoco...
Q5V1R5                 --------------------------------------------------------------------------------      Haloarcu...
Q11ZE1                 --------------------------------------------------------------------------------      Polaromo...
WP_011715030           --------------------------------------------------------------------------------      Magnetoc...
mgcchina:PST_0109      --------------------------------------------------------------------------------      Pseudomo...
Q6QGJ1                 --------------------------------------------------------------------------------      Escheric...
P32282                 --------------------------------------------------------------------------------      Escheric...
jgi:Rmag_0523          --------------------------------------------------------------------------------      Candidat...
6CGL_A             382 ---------------------------------------------------CSEVLQasqvssytdYDEEDeigl----- 405 
WP_012021658       445 ---------------------------------------------------CGEEPL---------LPWES--------- 455  Metallos...
Q5JJ43            1246 ykmeklslqktkidepvvtvesvevlgeeivydftvpehhsyisngfmshnCGEEPL---------YEYES--------- 1307 Thermoco...
Q5V1R5             434 ---------------------------------------------------CGEQPL---------EEYEA--------- 444  Haloarcu...
Q11ZE1             301 ---------------------------------------------------CAEQPL---------PPYGC--------- 311  Polaromo...
WP_011715030       318 ---------------------------------------------------CGEQPL---------PPYGA--------- 328  Magnetoc...
mgcchina:PST_0109  353 ---------------------------------------------------CGEQPL---------PPYGS--------- 363  Pseudomo...
Q6QGJ1             479 ---------------------------------------------------CVEITQ---------PTRPFhhitelykt 498  Escheric...
P32282             437 ---------------------------------------------------CCEIAI---------PTN-Dvnspd---- 451  Escheric...
jgi:Rmag_0523      439 ---------------------------------------------------CMEITL---------PTKPLysvqde--- 455  Candidat...
6CGL_A             406 --------------disCNLGSLNILNVM-------------------------E---HK-----SIEKTVKLATDSLTH 438 
WP_012021658       456 -----------------CNLGSLNLEKFVk------------------------ErdgTPyidwdDLANTIRYAVRFLDN 494  Metallos...
Q5JJ43            1308 -----------------CNLASINLAKFVk-----------------------yDdegKPyfdwdEYAYVIQKVAKYLDN 1347 Thermoco...
Q5V1R5             445 -----------------CNLGHINLSTLAatdapdwrvwseahadeydsidaaiDaflEEaidwdEFDRRIELGTRFLEN 507  Haloarcu...
Q11ZE1             312 -----------------CDLGPIILPKFVs-----------------------rAfteRAafddeGFKAAVKIQTRFLDN 351  Polaromo...
WP_011715030       329 -----------------CLLGSVNLARFVk-----------------------nPftaKAefdwaRFKEVVAVFTRMLDN 368  Magnetoc...
mgcchina:PST_0109  364 -----------------CLLGSINLTHFVi-----------------------dPfgvEArfdwdKYREVVRVFTRMLDN 403  Pseudomo...
Q6QGJ1             499 keqldqmkpedigevslCNLGGVVLGRMEsl---------------------------------aEWEKTCYILLKFVDT 545  Escheric...
P32282             452 ------------aeiglCTLSAFVLDNFDwqd-------------------------------qdKINELAEVQVRALDN 488  Escheric...
jgi:Rmag_0523      456 -----------qgevalCTLSAVNLGALDsl---------------------------------nEMEALTDIIVRSLDC 491  Candidat...
6CGL_A             439 VSETtDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANTFFMMVNFYSIQRSAEIAKEKGeTFD--- 515 
WP_012021658       495 VVDA-NRYPLPQIEQATKRTRKVGLGVMGLARALIKLGIPYDSVDAVYVSYYLAKFIYYHAMKTSIELAKEKG-SFP--- 569  Metallos...
Q5JJ43            1348 AIDV-NKFPLPEIDRNTKLTRRIGVGMMGLADALFKLGIPYNSKEGFDFMRKATEYLTFYAYKRSVEAAKERG-PFP--- 1422 Thermoco...
Q5V1R5             508 VVTM-SDFPVEKIEQKVREMRKIGLGIMGLAQLYIQLGVAYGTEEANEIARQTMRHINHGSKAASHELAEERG-VFT--- 582  Haloarcu...
Q11ZE1             352 VLSV-THWPLEQQRKEAEAKRRIGAGFTGLGDMLAMLGIRYNSIEGVEFSRHVALMMRDAAYEASIDLAIEKG-PFP--- 426  Polaromo...
WP_011715030       369 VVEI-HGLPLPGQADEIAHKRRHGMGFLGLGSTLTMLNMVYGDRQSVEFTSQVAREMALTGWEVGLELANEKG-PAPvmn 446  Magnetoc...
mgcchina:PST_0109  404 VVEI-NGLPLEQQRHEIESKRRHGMGFLGLGSTLTLLKLRYGSPEACVFTEEVSREMALVGWEQALELSKEKG-PAPlls 481  Pseudomo...
Q6QGJ1             546 IIEI-QDYPFPTMEYTAKKRRNVGIGLMNAAGAMAAEGLAYEGIEARNWIHREAEKLSYFLHKASVRLAKEQG-ACE--- 620  Escheric...
P32282             489 LLDY-QGYPVPEAE-KAKKRRNLGVGVTNYAAWLASNFASYED--ANDLTHELFERLQYGLIKASIKLAKEKG-PSE--- 560  Escheric...
jgi:Rmag_0523      492 LLDY-QDYPIKAAELSSKSRRTLGIGVTNLAYYLAKNGVKYSDGSGNQLIHKTFEALQYYSLKASNTLAKELG-VCP--- 566  Candidat...
6CGL_A             516 --------------QY--EG-------------STYATGE-YFDKYvst---dfSpkyekianlfegmhipttedWKKLK 562 
WP_012021658       570 --------------AY--DP-------------VRYKDV------------------------------------WESAR 584  Metallos...
Q5JJ43            1423 --------------LY--EK-------------TRYKDGElPVEGFyhreiwnlP--------------------WDELV 1453 Thermoco...
Q5V1R5             583 --------------EW--EN-------------SKYANPTdYSDWFekqtgedaAd-------------------WED-- 612  Haloarcu...
Q11ZE1             427 --------------LF--DA-------------DKYLKKGtFASRL-----------------------------PKSLK 448  Polaromo...
WP_011715030       447 qmytiteammakrpEManDGicvgdqlpgkvlmARYSRYMaKFPE--------------------------------RLR 494  Magnetoc...
mgcchina:PST_0109  482 qnfevtaemlrkrpEMakDGykvgdqiagrvlhAKYSRYMqKIAEY-----------------------------APDLI 532  Pseudomo...
Q6QGJ1             621 --------------WF--NR-------------TKPSKGIlVIDTYkktvdelvSvgl--------------emdWESLR 657  Escheric...
P32282             561 --------------YY--SD-------------TRWSRGElPIDWYnkkidqiaApky--------------vcdWSALR 597  Escheric...
jgi:Rmag_0523      567 --------------LF--SQ-------------TQYSQGImPIDSYkkdidafcDckl--------------eldWDTLR 603  Candidat...
6CGL_A             563 A----------------------------------FVA-EHGMYHSYRLCIAPTGSISYV--QSSTASVMPIMERIEERT 605 
WP_012021658       585 EldeiltisgirgkpsdyakklmseaekldvtvlkDMRlKYGLRNATVVSVAPTGTISII--AGTSSSIEPLFALAFIRN 662  Metallos...
Q5JJ43            1454 E----------------------------------EIK-KYGVRNGMVTTCPPTGSVSMI--ADTSSGIEPIFALVYKKS 1496 Thermoco...
Q5V1R5             613 ---------------------------------------GYPIRNHNTTTIAPTGTTSMI--GNTTGGCEPIYNVAYYKN 651  Haloarcu...
Q11ZE1             449 D----------------------------------RIR-RHGIRNSHLLSIAPTGTVSLAfaDNASNGIEPPFALAYTRK 493  Polaromo...
WP_011715030       495 K----------------------------------RIE-TEGSRFSHHSSIAPTGTISLSlgNNVSNGIEPSFAHKYSRN 539  Magnetoc...
mgcchina:PST_0109  533 E----------------------------------ALA-EQGARFTHHSSIAPTGTISLSlaNNASNGIEPSFAHHYSRN 577  Pseudomo...
Q6QGJ1             658 A----------------------------------DIL-KYGMRNSVLTAQMPGESSSVL--LGVTNSIEPPRKIVSIKG 700  Escheric...
P32282             598 E----------------------------------DLK-LFGIRNSTLSALMPCESSSQV--SNSTNGYEPPRGPVSVKE 640  Escheric...
jgi:Rmag_0523      604 Q----------------------------------NIK-STGLRNSTLTALMPCESSSQI--SNSTNGIEPPRGFVSIKQ 646  Candidat...
6CGL_A             606 YGNsktyyp-----------------------------------------mpglaSNNWFFYKEAYDM---DMFKVVDMI 641 
WP_012021658       663 VAVgkfmeidplfleylrkyeldt-----------pdvvkkiaetgevgdnpfvpKTIRKLFRTAHEV---EPMYHVLHQ 728  Metallos...
Q5JJ43            1497 VTVgefyyvdpvfeaelkkrglws----------deilkkisdnygsvqgleeipEDMQRVFVTAMDI---HWLDHILAQ 1563 Thermoco...
Q5V1R5             652 VsddvqgdemlvefddyflraledndidveavkqeaqeqmannefdgvdglttvpDAIGELFVTTGDL---SAKQHAGIQ 728  Haloarcu...
Q11ZE1             494 KRVgdghvnynvvdhafrvfletvcaqel-raplleavsryqpafevagktyqvkDCIPPSIVTAQEM---SAAEHLAVM 569  Polaromo...
WP_011715030       540 IIRegrktkekvdvfsyella-----------------yralvnpdadpyaeeekNLLPATFLDSNAI---NPRAHVDIQ 599  Magnetoc...
mgcchina:PST_0109  578 LIRpgrkakekievfsyella-----------------yrtlinarakpgsdepgEKLPDYFITADDV---SPTQHVDIQ 637  Pseudomo...
Q6QGJ1             701 SAVnkviai----------------------------------------apgatdWETLMSYKLAYDV---DRIEWIKWV 737  Escheric...
P32282             641 SKEgsfnq------------------------------------------vvpniEHNIDLYDYTWKLakkGNKPYLTQV 678  Escheric...
jgi:Rmag_0523      647 SKDgilkq------------------------------------------ivpeyERLKNQYELLWDIk--DNEGYLQLC 682  Candidat...
6CGL_A             642 ATIQQHIDQGISFTLFLk------DTMTTRDLNRIDLYAHHRGIKTIYY 684 
WP_012021658       729 AAWQQWNDSGTSKTINLr------SEEPADTVEKVYMTAWKLGIKGITV 771  Metallosphaera sedula
Q5JJ43            1564 ANIQLWLTDSASKTINMp------NDATVEDVKAAYLLAYKLGCKGVTV 1606 Thermococcus kodakarensis KOD1
Q5V1R5             729 VACQEGVDSAISKTVNAp------NDSTTEDAAEVFEYIYDHGGKGVTY 771  Haloarcula marismortui
Q11ZE1             570 AAVQPLIDTAISKTVNVp------EDYPYDDFKNLYMQAWKANLKGLAT 612  Polaromonas sp. JS666
WP_011715030       600 AAAQEWVDSSISKTINVp------TDFPYDEFKDIYLYAYEKGLKGCTT 642  Magnetococcus marinus
mgcchina:PST_0109  638 AAAQKWVDSSISKTANVp------TDYPFEAFKDIYRYAWRQGLKGCTT 680  Pseudomonas stutzeri A1501
Q6QGJ1             738 ATMQKFFSQSISTNMYYdytkfenEIIPGPVVVRDFMTAVKYGWKTWYY 786  Escherichia virus T5
P32282             679 AIMLKWVCQSASANTYYdpqifpkGKVPMSIMIDDMLYGWYYGIKNFYY 727  Escherichia virus T4
jgi:Rmag_0523      683 GIMQKFVDQSISTNMHYdpsqfegNRVPMKLFLMDLFRAYKYGIKTLYY 731  Candidatus Ruthia magnifica str. Cm (Ca...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap