1YVL,4ZIA,1BGF


Conserved Protein Domain Family
STAT_int

?
pfam02865: STAT_int 
STAT protein, protein interaction domain
STAT proteins (Signal Transducers and Activators of Transcription) are a family of transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors. STAT proteins also include an SH2 domain pfam00017.
Statistics
?
PSSM-Id: 397135
Aligned: 55 rows
Threshold Bit Score: 71.4754
Threshold Setting Gi: 2500903
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YVL_A         2 SQWYELQQ-LDSKFLEQVHQLYDDS-FPMEIRQYLAQWLEKQDWEHAA-------NDVSFATIRFHDLLSQLDDQYSRFS 72  
NP_001157388   2 TLWTRAQQ-LPPECLQKVRMIYVDH-FPIEVRHCLASWIESRIWTA---------EPEDQQRSFVNELVQEIQTNADLML 70   domestic silkworm
EFN82765       2 SLWAKSQQ-LPNEALKQVHAMYGDH-FPIEVRHFLSSWIEEKM-PDIDpd---npQHEQYVTNFVESMIHELESKAATFT 75   Jerdon's jumpi...
XP_397181      2 SLWAKAQQ-LPQDALQQVRSVYGEH-FPIEVRHFLSSWIEEKMWTDIEpd---npQYEQYIATLVRSLIQELETKAASLN 76   honey bee
ETN58242       2 SLWARVNQ-LPQHILEQIRFIYGSN-FPIEVRHYLAEWIEERLQNASMfindqenAYEQEAANFLNQLIIELERTAVSLP 79   Anopheles darl...
Q16V47         2 SLWARVNQ-LPQPVLEQIRYIYGNS-FPIEVRHYLAEWIEERLLNVPVyqheqdsAYEQEAATFLNQLINELERTAINLP 79   yellow fever m...
XP_011261579   2 SLWARAQQ-LPEDLLEEIRAVYAENtFPIEVRHYLSVWIEEKLLNIVEsn----iHNEQYISDLIGALIQELETKANNIQ 76   Florida carpen...
EEC07239       2 ALWGRLQE-LPRDLLRQCQLIYGEH-FPIEVRCALAPWIEDKPWGEMDpd---spAFEMYAPNLVASLLEELQAKAN--- 73   black-legged tick
XP_001946645   6 A-WEKLQQnLHGEDFHQI---YNDH-FPIEVRQLLSPWFETKAWTEIDpd---nlEHEGYIKGLFVSFVDELVSKANSMV 77   pea aphid
XP_969477      2 SLWAKAQQ-LPPESLQQIRSIYGDH-FPIEVRHYLAHYIEEKFWSDIDpvp-dnpQHEQYVAGLVNSLIQEVENKAAVVN 78   red flour beetle
1YVL_A        73 LENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ 120 
NP_001157388  71 SPDMFVTKMKLLEAAKNFHMQYSHAPQELYAYMRRCLALEMEVIQNAM 118  domestic silkworm
EFN82765      76 SDDFFITRIKLTEAAKSFRHKYLQNPAALFKIIKHCLALEMKYVQQVe 123  Jerdon's jumping ant
XP_397181     77 TDDMFLTKLKLMEAAKNFRQRYTHNPAALFRIIRHCLGTEMKLVAQVE 124  honey bee
ETN58242      80 ENN-LTIKIRLNESARNFRQLFSHNPSQLYHHLITCLQRERQCVAYPE 126  Anopheles darlingi
Q16V47        80 EDN-VTGRIRLNESARNFRQLFSHNPVQLYSHLINCLQRERQCIAYPE 126  yellow fever mosquito
XP_011261579  77 SGEMFLTKLKLMEAAKLFRQKYGEDPMRLFHTIRYCLGAEMKLVAQVE 124  Florida carpenter ant
EEC07239      74 SEDNFVMKLKLLEACSSFKQNYSHNPGALIRVIKNCLATEMRIVQQAE 121  black-legged tick
XP_001946645  78 TNEQFVSKLKLIDTAKLYKEKYSQNPKELIRIIKKCLESESIMAQQNN 125  pea aphid
XP_969477     79 DAEYFLTKLKLAEAAKMFRQRYSSNPMQLFSYVRQCLATEMRLVQAAN 126  red flour beetle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap