4Y0B,6N8V,1R6O,4Y0B,6EM8,5GUI,5GUI,3J3U


Conserved Protein Domain Family
Clp_N

?
pfam02861: Clp_N 
Click on image for an interactive view with Cn3D
Clp amino terminal domain, pathogenicity island component
This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes. The function of these domains is uncertain but they may form a protein binding site. In many bacterial species, including E.coli, this region represents the N-terminus of one of the key components of the pathogenicity island complex that injects toxin from one bacterium into another.
Statistics
?
PSSM-Id: 397131
Aligned: 129 rows
Threshold Bit Score: 29.4118
Threshold Setting Gi: 326515338
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4Y0B_A  35 GELEARKLKYPSTGTEAILXGILVEGTSTVAKFLRGNGVTLFKVRDETLSLLG 87  thale cress
P74459  96 ADAARSSWEDKFISVEHLLVG-FAEDDRVGRKTLRAFNLDPQDLELAIKAIRG 147 Synechocystis sp. PCC 6803 substr. Kazusa
P53532  95 AQELAGELGDEYVSTEVLLAGIAR-GKSDAADLLTNKGATYDAIKEAFPSVRG 146 Corynebacterium glutamicum ATCC 13032
O83110  94 AERLALKNQDEYVSCEHLLLAISE-TDSNTARLLHSQGITSKTISAALKDIRG 145 Treponema pallidum subsp. pallidum str. Nichols
O84115  92 AHQEARSMGDEYLSGDHLLLAFWRSTKEPFASWRKTVKTTSEALKELITKLRQ 144 Chlamydia trachomatis D/UW-3/CX
Q8XRT2  23 AASLCMARGNYEVDLEHLFLALLENRRSDFAVAARASGIDPAALQRDLEAEVG 75  Ralstonia solanacearum
Q9I1A8  21 AAQRCLQRTHHYVEIEHLLLELLDIDGGDFACLLPRFGLERDALVAEINLSLE 73  Pseudomonas aeruginosa
Q9F3K2 133 ALRVAVARRDRHIGDEHLLLALALRP-GVPAEVLADHGVTHASLSRVLDEGAG 184 Streptomyces coelicolor
Q9X1B1  98 AREEARRMGDSKIGTEHLILGMVLSPDSTAFRILSRYGVTPERVYEAIRKIRS 150 Thermotoga maritima
Q9X8L2 109 AHNAAKTAGNAEGLPEHLVLGLVTERESLSAKAIAAQGVTLDAIHEAATAALP 161 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap