4M52,6AWA,1V59,1XDI,2C3C,3DGH,1H6V,2HQM,1GRA,1GES,5V36,2NPX


Conserved Protein Domain Family
Pyr_redox_dim

?
pfam02852: Pyr_redox_dim 
Click on image for an interactive view with Cn3D
Pyridine nucleotide-disulphide oxidoreductase, dimerization domain
This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases.
Statistics
?
PSSM-Id: 397129
Aligned: 83 rows
Threshold Bit Score: 67.1946
Threshold Setting Gi: 81551510
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4M52_B 348 PRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGD--PSGFVKLVADAKHGELLGGHLVG-HDVAE--LL 422 Mycobacterium tubercu...
O28421 326 FSTFVGDVALGAAGLTEEMAKKEG--FEVVAGYGESLNRHLASIPgaAKTKVKLIFAKESGVILGGQVTGrYEVGE--MV 401 Archaeoglobus fulgidus
Q58065 327 AVSKIGDLEIGGTGLTAFSANLKRIPIVIGRAKA--LTRARYYPg-gKEIEIKMIFNE-DGKVVGCQIVGgERVAE--RI 400 Methanocaldococcus ja...
O29985 320 QLTGFKDIEIGKAGLSENEAIRFG--YEVVSAFITSRTSARYLPG--GLIHLKVVADR-NGKLLGLQAVG-KDVAM--RV 391 Archaeoglobus fulgidus
O29852 320 QLTKFFDLEIGATGLTEKAAKAEG--FEVKTAVVKAKTRVHYYPg-aKDTFLKVVADASTKRILGAQVLG-ADVAM--RV 393 Archaeoglobus fulgidus
O69869 342 AVSKVCDLEIARTGLREKDALRAG--LRFVTATVESTSRAGYYPn-aSPMTVKMLAERRTGRLLGVQIVG-R-EGAgkRV 416 Streptomyces coelicolor
Q9RVN5 327 SIFKVFGLGVARTGLTQGEAAALG--LNAVSVDVTSTDHAGYYAd-aRPIHVRLTGERGTGRLLGGQLVA-ENPLSvkRV 402 Deinococcus radiodurans
O29847 333 AIFKVFDFTAASAGVNEQMAKEAG--LDYFTVIAPSPDRAHYYPq-aNYIRLKLIVEKGSWRVIGAQGVG-M-GEVakRI 407 Archaeoglobus fulgidus
O51670 328 ASIKILSLEAARTGLTEKDAKKLQ--IKYKTIFVKDKNHTNYYPGq-EDLYIKLIYEENTKIILGAQAIG-KNGAVi-RI 402 Lyme disease spirochete
2NPX_A 327 SGLAVFDYKFASTGINEVMAQKLG--KETKAVTVVEDYLMDFNPd-kQKAWFKLVYDPETTQILGAQLMS-K-ADLtaNI 401 Enterococcus faecalis
4M52_B 423 PELTLAQRWDLTAS-ELARNVHTHPTMSEALQE 454 Mycobacterium tuberculosis
O28421 402 NQIAMAIQNNLTASeIDTLQIGTHPLLTSAPTT 434 Archaeoglobus fulgidus
Q58065 401 DAMSIAIFKKVSAEeLANMEFCYAPPVS--MVH 431 Methanocaldococcus jannaschii DSM 2661
O29985 392 YAASALLHKNGDVKdLFFCDFPYYPPVS--RVW 422 Archaeoglobus fulgidus
O29852 394 NVFAAMIQGGFTTKdVFFADLGYAPPFT--PIW 424 Archaeoglobus fulgidus
O69869 417 DIAAVALTAGMTVEqMTALDLGYAPPFS--PVW 447 Streptomyces coelicolor
Q9RVN5 403 DVIAAHLHSRGKVEdLFQMDLAYAPPFS--GVW 433 Deinococcus radiodurans
O29847 408 DVLSTAIQAGMTIDqLANLDLAYAPPYSPALDP 440 Archaeoglobus fulgidus
O51670 403 HALSIAIYSKLTTKeLGMMDFSYSPPFS--RTW 433 Lyme disease spirochete
2NPX_A 402 NAISLAIQAKMTIEdLAYADFFFQPAFD--KPW 432 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap