2DHY,2MYX,1P3Q,2DI0,2EJS


Conserved Protein Domain Family
CUE

?
pfam02845: CUE 
Click on image for an interactive view with Cn3D
CUE domain
CUE domains have been shown to bind ubiquitin. It has been suggested that CUE domains are related to pfam00627 and this has been confirmed by the structure of the domain. CUE domains also occur in two protein of the IL-1 signal transduction pathway, tollip and TAB2.
Statistics
?
PSSM-Id: 397127
Aligned: 117 rows
Threshold Bit Score: 32.8354
Threshold Setting Gi: 21431870
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DHY_A        18 FNQAMDDFKTMFPNMDYDIIECVLrANSGAVDATIDQLLQMN 59  human
XP_001624449 299 LLRMAQQVREVLPQVPIDVIQRDL-SKSRCVDTTISNILEGR 339 starlet sea anemone
A9ULG4       287 qMQMAQHVKEVLPQVPLSAIHRDL-GHTGCIDTTITNFLEGR 327 tropical clawed frog
A1L134       297 LTILAQRVKEVLPHVPLNVIQRDL-ARTGCVDLTITNLLEGA 337 Norway rat
Q6PBN5       305 IARLAQQVKEVLPDVPVSVITRDL-LQTNCVDTTITNLLERT 345 zebrafish
XP_001237062 443 VRNMARHVQEMFPRYPLSVLIGDL-QISRSIEVTIDNILEGR 483 Anopheles gambiae str. PEST
EDO34524     363 VEAMAHQVHAMFPHVPINIITEDL-RQTHSIELTTDNFLEGR 403 starlet sea anemone
P90859       433 LQTMLEQVREMFPQMSVDIIMTDL-RQSGSAQSTIENILEGR 473 Caenorhabditis elegans
P87238        49 NSEHVHLVKTVFPHLESSAIAYDL-QKTKNVDATIENALRGQ 89  Schizosaccharomyces pombe 972h-
2EJS_A        13 lNAMAHQIQEMFPQVPYHLVLQDL-QLTRSVEITTDNILEGR 53  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap