6K1Z


Conserved Protein Domain Family
GBP_C

?
pfam02841: GBP_C 
Guanylate-binding protein, C-terminal domain
Transcription of the anti-viral guanylate-binding protein (GBP) is induced by interferon-gamma during macrophage induction. This family contains GBP1 and GPB2, both GTPases capable of binding GTP, GDP and GMP.
Statistics
?
PSSM-Id: 397124
Aligned: 24 rows
Threshold Bit Score: 267.231
Threshold Setting Gi: 125553313
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6K1Z_A 286 GGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKV-QLPTETLQELLDLHRDSER 364
Q0IID3 284 GGIKASGSHLENLVQTYVNAINSGDLPCMESEVLTLAQIKNLAAVQKAIAHYDQKMGQKL-QLPTETFQELLDLHRASEK 362 cattle
Q8CFB4 283 GGIQVNGPRLESLVLTYVDAINSGALPSIENTVVTLARRENSAAVQKAIGHYDQLMSEKV-QLPTETLQELLDLHRTCER 361 house mouse
Q8N4Q4 177 GGIMVNGSRLKNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKV-QLPMETLQELLDLHRTSER 255 human
Q0IJ14 282 GGLLVTGRMLAHLTSLYIETIMSGSVPCMENAILALSVIENTGAVQDALAKYETCMNEHLpRFPTETLQEFLHLHQGSEK 361 tropical clawed frog
Q7T0S6 283 GGLLVTGRMLAYLVNLYIETIKSGSVPCIENAVLALSVKENTGAVQDALKMYETCMNDQVaRFPTETLETFLQMHQDCEK 362 African clawed frog
Q6DHP7 283 GGHKVTGKLLGHLAKIYVDTISSGKVPCLDNAVVALANLENKCAVEEAFKVYERGMEEVKkTFPVN-VDEISSEHQRFSS 361 zebrafish
Q6YLY1 276 GGHTLTGEMLGHLVTTYVETIAKGNVPCLENAVLAMAKIENQAAVNEGLAVYQKGMEDVKaLFPVD-VNQLSENHLQSET 354 rainbow trout
Q66J21 276 GFRPANGNMLGDLAQKYTEAISNGHAPCMENAVLSLSENENNAAVEKALEHYETEMVKKV-VFPTETMNQFMDLSKECEQ 354 African clawed frog
Q90892 279 GGHQVTGSALAYLVEKYMAAISSGSVPCVESTLKALAQAENTAAVQVAVAEYQRGMEQGL-VLPTASYDALLAVHRDCEQ 357 chicken
6K1Z_A 365 EAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQD 444
Q0IID3 363 EAIEVFMKNSFKDEDQGYQKKLEMQLAAKQNDFHERNLEASQNRCSALLQDIFHPLEENVKQGVYSKPGGHCLFIQQRDE 442 cattle
Q8CFB4 362 EAIEIFRKHSFKDEGEFFQKELESLLSAKQDEICKKNADASAALCSTLLGSIFKPLEQEVAQEFYHKPGGHKLFLQRMEQ 441 house mouse
Q8N4Q4 256 EAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAVKQGIYSKPGGHNLFIQKTEE 335 human
Q0IJ14 362 EALEVFLKRSFNDENQDFQKEFKNLLDNKMKEFSERNERESTERCQTIIQKLSESLEQRISQGEFSKPGGHKLFLKEKMT 441 tropical clawed frog
Q7T0S6 363 EALKVFMKRSFNDENQKFQQEFKELLDGKMKEFSALNESKSTERCQIIIQQLSAALDQRISQGEFLKPGGYMLFLEEKRT 442 African clawed frog
Q6DHP7 362 LANAEFMKRSFKDEKQEYINQLKEKIDVYYGCLLEDNGLASKKKCEDLLKDLFSEMNKKLQDGVYSQPGGYELYCKDRDV 441 zebrafish
Q6YLY1 355 QATKAFMKRSFKDDNGEFLKALAEAIVNHSDDLFKQNKDASEKKCKALLENLSALMDQGMKEGTYATPGGYGLYCNHHDN 434 rainbow trout
Q66J21 355 QAVDIFMTRSFRDKDHRFQKELMGSIQKKKNELLKKNEEASVAYCDDLLSKLTNDLDKAITDGSYIVPGGYQKFKEEMDK 434 African clawed frog
Q90892 358 RALALFLSRAFADHKHQYHDELVHKLEAAKEEFCQRNKEASEQRCRTVLQELWRDVELRLQRGDYVARGGAQLFKEDVNR 437 chicken
6K1Z_A 445 LKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQKER 524
Q0IID3 443 LKAKYNQEPRKGIQAEEALQKYLESKESMSVTILQTDLALTAMEKEM--EGITEEFIKAEAQRLMESLMQHQQMMESRKI 520 cattle
Q8CFB4 442 LKANYRQQPGKGTQAEEVLQTYLNAKETVSRTILQTDQVLTDKEIQSKAEQERAEAARLEAQRLEAIRIQEEQRKAEMER 521 house mouse
Q8N4Q4 336 LKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQALTETKKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERER 415 human
Q0IJ14 442 IMEEYNTTPHKGLKSLEVLQEFISNKKATEAAILQADESLTAKEKEIAESQAETAEAERQRQILEEKEKYLQESMENQKK 521 tropical clawed frog
Q7T0S6 443 IMAKYDTAPQKGLKSLEVLQEFMNNLKAIEATILQADESLTAKEKQIAESQAEAEAAKRQMQILEEHARSLQESLENQKK 522 African clawed frog
Q6DHP7 442 IVEKYRREPNKGVLAEAVLHEFLNERGAEANSILYTDTKLTENDKKIQEEKERNALMQQKCEEEQEKRIESERMMAAEKV 521 zebrafish
Q6YLY1 435 IVAQYRAEPNKGVRAEEVLEQFLKDKSAESYSILQADKQLTKKEKQIQAEKKKTAELEQEKAAFREQQAEMERTIENNRI 514 rainbow trout
Q66J21 435 IVGQYNENATKGIKGDEVLQRFLKSKEGTGNTILISDKALDEKEKLKEAEKAKAESLMMERKVSNVKASQDEQKDDGQMN 514 African clawed frog
Q90892 438 VLEEYKQRPDKGVRAEAVLKEFLREHEGLAQVLKATEVQLELAERQQEAAAAEAEAARKATEAWR----------EDQKR 507 chicken
6K1Z_A 525 SYQEHLKQLTEKMENDRV-QLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQ 582
Q0IID3 521 FHQEQVRL----METNRV-YQEALQQRAMERQLQEEVKKLKEKLQAENRKLHDELQNLL 574 cattle
Q8CFB4 522 QHQEQLRQ----IALEKA-RVAQEQQWILKQRAQEEADRIKAEQEAQLRALQQQLQHMR 575 house mouse
Q8N4Q4 416 LHQEQVRQ----MEIAKQ-NWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQ 469 human
Q0IJ14 522 SFEQHEKMLIEKMEADRQ-KLIAENGRVIAQKLQEQNAMLTAGFQSKVNDLQREIADLN 579 tropical clawed frog
Q7T0S6 523 SYEQHEKMLIEKMESDRR-NLIAENELVINQKLQEQNAMRIAGLKSNVDALQREINELK 580 African clawed frog
Q6DHP7 522 RQDDQIKQMQEKFEKERE-QMQQETEKAIDSKLKEQEEMLNKGFKERADLLSEEINDLK 579 zebrafish
Q6YLY1 515 SQEKYLKKMKEMMEEEREsHQQQEFNRTLERRMQEQKDLLENGHKEKAELMRQEILEIK 573 rainbow trout
Q66J21 515 SFQINIQRLVEKLEDEKR-MMRDQIERLVSEKRREEELLIRQGSAQQAKLYAAQIQDLE 572 African clawed frog
Q90892 508 SMEEHKRQLEQWMKKEKH-TWEEELNRMLEHHRKEYKALLQEGFRREAAAKEKQIRELQ 565 chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap