3T0B,3OB8,3GM8,3LPG


Conserved Protein Domain Family
Glyco_hydro_2_N

?
pfam02837: Glyco_hydro_2_N 
Click on image for an interactive view with Cn3D
Glycosyl hydrolases family 2, sugar binding domain
This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
Statistics
?
PSSM-Id: 397120
Aligned: 4 rows
Threshold Bit Score: 220.193
Threshold Setting Gi: 226192758
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3T0B_A   80 LRSLNGE-------WRFAWFPAPEAVPES----------WlecdlpeaDTVVVPSNWQMHgy---daPIYTNVTYPITVN 139  Escherichia coli K-12
3OB8_D   39 FESLNGP-------WAFALFDAPLDAPDAknldwetakkW--------STISVPSHWELQedwkygkPIYTNVQYPIPID 103  Kluyveromyces lactis
3GM8_A    1 --SLAGEtinfckgWKFHLGDAGKGASSSsyn----dsqW--------RILNIPHDWSIE-------GTYKQFENGTDWQ 59   Bacteroides vulgatu...
3LPG_B   14 IKKLDGL-------WAFSLDRENCGIDQR----------WwesalqesRAIAVPGSFNDQ------------------FA 58   Escherichia coli K-12
3T0B_A  140 PPFVPTENPTGCYSLTFNVDESWLQEgQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGEN-RLAVMV- 217  Escherichia coli K-12
3OB8_D  104 IPNPPTVNPTGVYARTFELDSKSIESfEHRLRFEGVDNCYELYVNGQYVGFNKGSRNGAEFDIQKYVSEGEN-LVVVKV- 181  Kluyveromyces lactis
3GM8_A   60 SGFLPA--GISWYRKTFTIPSKWKNK-KVQILFEGVYLNSEVWINGHWLGKRPNGYISFVYDLTPYLQEGKN-QIAVKV- 134  Bacteroides vulgatu...
3LPG_B   59 DADIRNYAGNVWYQREVFIPKGWAGQ-RIVLRFDAVTHYGKVWVNNQEVXEHQGGYTPFEADVTPYVIAGKSvRITVCVn 137  Escherichia coli K-12
3T0B_A  218 --LRWS---DGSYLEDQ----------DMWRMSGIFRDVSLL-HKP 247  Escherichia coli K-12
3OB8_D  182 --FKWS---DSTYIEDQ----------DQWWLSGIYRDVSLL-KLP 211  Kluyveromyces lactis
3GM8_A  135 ---------------DHska----ltgRWYTGSGIYRPVYLLvSNP 161  Bacteroides vulgatus ATCC 8482
3LPG_B  138 neLNWQtipPGXVITDEngkkkqsyfhDFFNYAGIHRSVXLY-TTP 182  Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap