3KB6,6ABI,2YQ5,1QP8,4DGS,3GG9,5TX7,4Z0P,2EKL


Conserved Protein Domain Family
2-Hacid_dh_C

?
pfam02826: 2-Hacid_dh_C 
Click on image for an interactive view with Cn3D
D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Statistics
?
PSSM-Id: 397112
Aligned: 138 rows
Threshold Bit Score: 138.383
Threshold Setting Gi: 74567504
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KB6_B 106 FAXILTLVKRLKRIEDRV----KKLNFs-QDSEILAR----ELNRLTLGVIGTGRIGSRVAXYGL-AFGX-KVLCYDVVK 174 Aquifex aeolicus
Q883D2 110 LGLMLGLRRRLFDGNGAV----KRS----FRPTVLSS----EVSASKIGIVGMGVIGSCLARMLTkGMGV-KVYYASRTR 176 Pseudomonas syringae ...
Q9YCJ2 108 VAAVLAALRGVVAGHMYTprwaREG-W---PSHLAGF----LVRGRSVGLLGAGRIGQSVAFKLA-ALGAgPFYYYSRSR 178 Aeropyrum pernix
1QP8_A  91 LALLLAPYKRIIQYGEKX----KRGDY--GRDVEIPL-----IQGEKVAVLGLGEIGTRVGKILA-ALGA-QVRGFSRTP 157 Pyrobaculum aerophilum
Q7VJR5 105 LSMALNLLARLHYYDEYC----KSGAWarSKIFVHINgglrEIENLQWGIIGFGSIGQRVARLAQ-SFGA-KVSYYSTSG 178 Helicobacter hepaticus
Q8ES01 104 FAYMLGFTRLIHTYIRQQ----QEKKW---HHANLKA----EIHEKTIGIIGVGEIGKETAKIAQ-AFGM-KVLGVRHSG 170 Oceanobacillus iheyensis
Q9KEA4 104 LSMMLQVARNAKRLISLE----QEQTW---DRRVPMI----ELNGQTVGVLGAGAIGQEIARLAK-AFRM-KTIGMNSTG 170 Bacillus halodurans
Q8Y6K0 102 LSFMLAHVKKAAFFYQMQ----KEKNW---ASEEPIT----ELAGKTLVVAGTGAIGAKVAEFAQ-AFDM-EIIGVNTTG 168 Listeria monocytogenes
Q2G281 104 lAFILDDYKKMKLSYDNQ----RQHIY---DSKITGK----RLSGQTVLFLGTGAIATRTAKLAK-AFNM-NLIGLSKSG 170 Staphylococcus aureus...
Q97M35 104 VWSILSTYKEANIFFQNK----QDKKW---KLRTSLR----EIFGETVGILGTGHIAIETAKRLQ-AFGV-NVLGLNTTG 170 Clostridium acetobuty...
3KB6_B 175 Re--dLKEKGC-VYT-SLDELLKESDVISLHVPYTKETHHXINEERISLXKDGVYLINTARGKVVDTDALYRAYQRGKFS 250 Aquifex aeolicus
Q883D2 177 Krd-iEDDLGL-VWC-TLQEIFATCDIVSLLVPLTPDTRFFVNDALLKLSPKHQVIINTADANLIDPASLKAALQDKRIE 253 Pseudomonas syringae ...
Q9YCJ2 179 Kpg-lEAVLGA-KRL-EPRELFSRSMILVNSLPLTGETRGLVTAGLLRLLPRGAVYVNVGRGGTEEPGAVEAVASEREDL 255 Aeropyrum pernix
1QP8_A 158 K-------EGPwRFTnSLEEALREARAAVCALPLNKHTRGLVKYQHLALXAEDAVFVNVGRAEVLDRDGVLRILKERPQF 230 Pyrobaculum aerophilum
Q7VJR5 179 Knt-qSAFTRK-----ELNEILSQSDIISIHAPLNDKTKNLINRTNLPLLKDEAVLINVGRGGIVNEKDIAQILKS-KLM 251 Helicobacter hepaticus
Q8ES01 171 RpleyVDEMYT--PA-DLSLVLEQSDFVVVTLPLTKDTHHMFGKEQFAQMKNSAFFINIGRGPIVDESALISALQQKEIA 247 Oceanobacillus iheyensis
Q9KEA4 171 RtvssFDQIVP--PA-SVDTLLKNSDFVVSVLPFTKRTEGFMTYERFQLMKPSAVFINIGRGKTVKQTELLKALEEKAIS 247 Bacillus halodurans
Q8Y6K0 169 HpakpFSETYA--MT-NIEKVAPLADFFVSVLPHTDETMGIYSLSFFEKMKNNAVFINIGRGSAVELNVLEKASKDQLIA 245 Listeria monocytogenes
Q2G281 171 QnkdeFDE-IY-TIE-SLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEVLKSKVIR 247 Staphylococcus aureus...
Q97M35 171 Rk--vEYFNECyAKD-RVEEMIKECDVVVSLLPITDETHHFINERIFLLMKNGVVFVNASRGKVVEEEKLIKFLKNGKIR 247 Clostridium acetobuty...
3KB6_B 251 GLGLDVFEDEeililkkytegKAT--DK----NLkileLAcKDN-----VIITPHIA 296 Aquifex aeolicus
Q883D2 254 AAAFDGYYVE-----------PIPavEDd---PFgfleLS-DNV-----FVITPHGA 290 Pseudomonas syringae pv. tomato
Q9YCJ2 256 YFVLDVHPEE-----------PLP--PSsgrmRL----HG-NPR-----VVMTPHIA 289 Aeropyrum pernix
1QP8_A 231 IFASDVWWGRn----------DFA--KDa---EF----FS-LPN-----VVATPWVA 262 Pyrobaculum aerophilum
Q7VJR5 252 YFATDVLESE-----------PME--ANh---PF-------LDKtiadkLLITPHVA 285 Helicobacter hepaticus
Q8ES01 248 GAGLDVFETE-----------PLQ--SDs---PL----WE-MEN-----VIITPHSA 278 Oceanobacillus iheyensis
Q9KEA4 248 HAVLDVFEEE-----------PLE--ENh---PF----WT-MDS-----VTVTPHLS 278 Bacillus halodurans
Q8Y6K0 246 HFYLDVLSEE-----------PLS--EDn---SL----WQ-ANN-----VTITPHVS 276 Listeria monocytogenes
Q2G281 248 HAYLDVFENE-----------PLK--PNh---EL----YE-LDN-----VTITAHIt 278 Staphylococcus aureus subsp. aureus NCTC 8325
Q97M35 248 AAALDVVEEE-----------PLS--KDs---PL----WQ-MNN-----VIITPHNS 278 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap