3NXZ


Conserved Protein Domain Family
UreE_N

?
pfam02814: UreE_N 
Click on image for an interactive view with Cn3D
UreE urease accessory protein, N-terminal domain
UreE is a urease accessory protein. Urease pfam00449 hydrolyzes urea into ammonia and carbamic acid.
Statistics
?
PSSM-Id: 397102
Aligned: 81 rows
Threshold Bit Score: 37.5618
Threshold Setting Gi: 81552114
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NXZ_B          15 PLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDApkLGLSQGDILFKEEKEII 71  Helicobacter pylori
WP_015871368    21 LKAYELDYLTLEHGDMYKNSCRKMTEQGKDLGISLERN--SLLADGDVLLCDDKHay 75  Edwardsiella ictaluri
WP_013287655    19 LREAKVDDLVLDQWDAQKSRLRRTTSLGTELALSLARG--VRLRDGDVLAWDDATat 73  Micromonospora
WP_013732464    19 LSNAKVDDLVLDQWEAQKSRLRKATSLGTELALTLSRG--VRLRDGDILAWDEltat 73  Verrucosispora
jgi:Odosp_1243  21 LKNTKIEYLELDQWTAQKSRFIAKGSDGQEYAVALKRH--SQIENGDILEYDPerkv 75  Odoribacter splanchnicus DSM 20712
WP_004237085    21 ANEMTVDMLILDQREAQKSRCRKHTQNGLDIGIALDRN--VLLSDGDVIHTDDAtnt 75  Morganella morganii
Q9ZFR8          21 LKDATFDLLILDQREAQKSRCRKSSTQGLDLGISLDRN--VVLADGDVLAWDEETNv 75  Yersinia pestis
Q56559          17 VESYQIENIHLTSDDVLKRVIIISSDQNVEYGIRLEED--KKLMDGDILYKDDYKLV 71  Ureaplasma parvum serovar 3 str. ATC...
CDB16755        16 LNGYHVETIYLNSEDMLKRILRVTSDHNREYGITLDNN--EKLKDGDILYNEDKKLI 70  Clostridium sp. CAG:221
ADL11364        18 RDALELDAVIFDNETRLKRVQRVTTESGAEYALRLGNEl-REIKDGDILAKEDNKVI 73  Corynebacterium pseudotuberculosis C231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap