4WO8,4WO8


Conserved Protein Domain Family
ATP-gua_PtransN

?
pfam02807: ATP-gua_PtransN 
Click on image for an interactive view with Cn3D
ATP:guanido phosphotransferase, N-terminal domain
The N-terminal domain has an all-alpha fold.
Statistics
?
PSSM-Id: 397097
Aligned: 88 rows
Threshold Bit Score: 67.1517
Threshold Setting Gi: 471223268
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WO8_A       380 SIEKCYTRKYLTPEIIKKYDGK-RT-THGATLAHMIRNGAYNNRS-ICPRTGEAECYSTFIDYLDPLIC 445 Schistosoma mansoni
XP_016767369  38 VESGSLLKKYLDRHVFNMLKTR-LT-NTQSSLMDVIQSGLKNLDSnVGIYAPDQHSYSVFAPLFNPVIE 104 honey bee
EKC24882      14 GESKSLLKKHCTKEVYEKLKDK-KS-KLGGTLADCIRSGALNLNSgVGVYACDPEGYEVFKELLDPVIM 80  Pacific oyster
EKC24881      14 TDCKSLLKKHLTPGVYQQLKDK-KT-KFGGTLIHCIQSGCQNLDSgCGIYASDPEAYDVFKEVLHPVIQ 80  Pacific oyster
Q177S3       109 EECSSLLKKHLTQEVFDELKQK-KT-TLKSTLLDCIQSGLENHDSgVGIYASDAECYELFAPLFNPIIE 175 yellow fever mosquito
EDS33211     105 EACTSLLKKHLTEEVFNELKEK-KT-ALKSTLLDCVQSGLEHHDSgVGLYAADAECYELFGALFKKVIN 171 southern house mosquito
ETN66134     106 QAADSLLKKHLTRELLDELKEQ-KTtVYRSTLLDCIQSGLNVLDSrIGLYAADPEAYKLFAGLFDPIIA 173 Anopheles darlingi
XP_002017034 110 ENVNSLLRKYLTPELLEEYMLVtTSpPVDAYLYDCAVSGFEHHDSsVGIYAADPDSYDVFAKIFDPIIK 178 Drosophila persimilis
A0D308        37 NIKVSLANKHYTQAVVEKVKTM-SA-EDQQRFLDIVIAGLTNDDSqVGISATRPEDYDVFLFYLEPIIR 103 Paramecium tetraurelia
Q7PYN5       108 EACDSLLKKHLTPEVLETLREL-KTpAFKSTLLDCVQSGLKNRDShVGVYAADPMAYSVFAALFDPLIE 175 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap