1M6V,2VQD,2GPW,5DOU


Conserved Protein Domain Family
CPSase_L_D2

?
pfam02786: CPSase_L_D2 
Click on image for an interactive view with Cn3D
Carbamoyl-phosphate synthase L chain, ATP binding domain
Carbamoyl-phosphate synthase catalyzes the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesize carbamoyl phosphate. See pfam00988. The small chain has a GATase domain in the carboxyl terminus. See pfam00117. The ATP binding domain (this one) has an ATP-grasp fold.
Statistics
?
PSSM-Id: 397079
Aligned: 16 rows
Threshold Bit Score: 266.093
Threshold Setting Gi: 13432116
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M6V_C    128 DRRRFDVAMKKIGLETARSGIA---HTMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSP---- 200  Escherichia coli
P18185    128 DREKFRSLMNELKQPVPESEIV---DNEADALHFAESIGFPVIIRPAYTLGGKGGGIAPDKEAFTAMIKQALLASP---- 200  Bacillus subtilis...
Q5L0U3    128 DREQFRALMNELGEPVPESAII---HSLEEAYAFVEQIGYPVIVRPAFTLGGTGGGICTNEEELVEIVSTGLKMSP---- 200  Geobacillus kaust...
P11154    135 DKVSARNLAAKANVPTVPGTPGp-iETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARtafg 213  Saccharomyces cer...
P46392    122 DKVTARHIAARAQAPLVPGTPDp-vKNADEVVAFAKEHGVPIAIKAAFGGGGKGMKVARTLEEISELYESAVREATvafg 200  Mycobacterium lep...
2GPW_A    135 DKVSAIAAMKKAGVPCVPGSDGplgDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKaafs 214  Escherichia coli
P03965    149 DRDLFASALKDINIPIAESFAC---ETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLA----- 220  Saccharomyces cer...
EKC98059  311 DRDLFVQALNEIDIPAAQSTAV---STIQDALDAAATIGYPIILRSAFSLGGLGSGFAHNEEELRNLAAKSLSLS----- 382  Trichosporon asah...
Q09794    593 DRELFARAMDEINEKCAKSASA---SSIEEAIKVSKDISFPVIVRAAYALGGLGSGFADNEAELIDLCTLAFATS----- 664  Schizosaccharomyc...
P20054    525 DRGIFAEKLSEINERIAPSMAC---NSLEESLIEAEKIGYPVIVRAAYCLGGLGSGFADNKEQLTALVTEAMATS----- 596  Dictyostelium dis...
1M6V_C    201 TKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMgiHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETG 280  Escherichia coli
P18185    201 INQCLVEKSIAGFKEIEYEVMRDSNNTCITVCNMENIDPVgvHTGDSIVVAPSQTLTDEDYQMLRTASLTIISALDVVGG 280  Bacillus subtilis...
Q5L0U3    201 VHQCLLERSIAGYKEIEYEVMRDANDNAIVVCNMENIDPVgiHTGDSIVVAPSQTLSDREYQLLRNASLKIIRALGIEGG 280  Geobacillus kaust...
P11154    214 NGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQR--RHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNA 291  Saccharomyces cer...
P46392    201 RGECFVERYLDKPRHVEAQVIADQHGNIVVAGTRDCSLQR--RFQKLVEEAPAPFLTDAQRKEIHESAKRICKEAHYYGA 278  Mycobacterium lep...
2GPW_A    215 NDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQR--RHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGA 292  Escherichia coli
P03965    221 -PQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLgvHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGE 299  Saccharomyces cer...
EKC98059  383 -PQVLIEKSLKGWKEVEYEVVRDAADNTIICCNMENFDPLgtHTGDSIVVAPSQTLTDDEYHMLRSAAIKIVRHVGVVGE 461  Trichosporon asah...
Q09794    665 -PQVLIERSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLgiHTGDSIVVAPSQTLTDEDYNMLRTTAVNVIRHLGVVGE 743  Schizosaccharomyc...
P20054    597 -SQVLVEKSLKGWKEIEYEVLRDSKDNCITVCNMENFDPLgiHTGESIVVAPSQTLSDREYQMLRETAIKTVRHLGVIGE 675  Dictyostelium dis...
1M6V_C    281 GsNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLD 333  Escherichia coli
P18185    281 C-NIQFALDPFSKQYYVIEVNPRVSRSSALASKATGYPIAKMAAKLAVGYTLD 332  Bacillus subtilis subsp. subtilis str. 168
Q5L0U3    281 C-NVQLALDPDSFRYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLD 332  Geobacillus kaustophilus
P11154    292 G-TAEFLVDN-QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLP 342  Saccharomyces cerevisiae S288C
P46392    279 G-TVEYLVGQ-DGLISFLEVNTRLQVEHPVTEETTGIDLVLQQFKIANGEKLE 329  Mycobacterium leprae TN
2GPW_A    293 G-TFEFLFE--NGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLS 342  Escherichia coli
P03965    300 C-NVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLP 351  Saccharomyces cerevisiae S288C
EKC98059  462 C-NVQYALDPVSRDYRVIEMNARLSRSSALASKATGYPLAYTAAKIALGHTLP 513  Trichosporon asahii var. asahii CBS 8904
Q09794    744 C-NIQYALNPFTKEYCIIEVNARLSRSSALASKATGYPLAFTAAKLGLNIPLN 795  Schizosaccharomyces pombe 972h-
P20054    676 C-NIQYSLNPYSEEYCIIEVNARLSRSSALASKATGYPLAFISAKVALGYDLA 727  Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap