1HBM,5A8R,1E6Y,1E6V


Conserved Protein Domain Family
MCR_beta_N

?
pfam02783: MCR_beta_N 
Methyl-coenzyme M reductase beta subunit, N-terminal domain
Methyl-coenzyme M reductase (MCR) is the enzyme responsible for microbial formation of methane. It is a hexamer composed of 2 alpha (pfam02249), 2 beta (this family), and 2 gamma (pfam02240) subunits with two identical nickel porphinoid active sites. The N-terminal domain has an alpha/beta ferredoxin-like fold.
Statistics
?
PSSM-Id: 397076
Aligned: 40 rows
Threshold Bit Score: 247.53
Threshold Setting Gi: 490181023
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HBM_B               5 DKVDLYDDRGNLVEEQVPLEALSPLRNPAIKSIVQGIKRTVAVNLEGIENALKTAKVGGPACKIMGRELDLDIVGNAESI 84 
AGN26874             6 DKIDLYDERGKLIESGVPLDAISPLYNPAIQRTASLAKRTIAVNLAGIEKSLKSGRVGG--GYIKGKEIDAPVVANAEKV 83  Candidatu...
licsiro:TALC_00469   6 DVIDLYDDYGKRIAKGVPLEAISPLRNKAIQKIASLTKRTVVVSLAGIEKALKTGAVGGN-NWIAGKEIDAPIVADAEKL 84  Thermopla...
Q2NI03               6 DKIDLYGVDGKLLEEQVPLEAISPVINPTIKNIIQEIKRSVAINLAGIEKSLANGAYGGKANFIPGRELELDIVDNADAI 85  Methanosp...
CDG65901             6 DKIDLYGADGKLLESDVPLEAVSPMLNPTIENIVQTVKRSVAVNLAGIEKSLEKAAYGGKANFIPGRELKLPIVDNVDTI 85  Methanoba...
Q58252               9 DTINLYDEKGKLVEENVPLEAISPLHNPTIQKLVKDVKRTVAVNLAGIENALRTGQVGGKGCMIKGRELDLPIVENAETI 88  Methanoca...
jgi:Maeo_1264        6 DKINLYDAKGNLAEENVPLEAISPLYNPVVKDMVKSIKRTVAVNLAGIEATLKAGTIGGKACRVPGRTLDLPIVDEAEAI 85  Methanoco...
jgi:Mvol_1124        6 DKICLFDAKGNQVAEDVPLEAISPLNNPTIMGMVKNIKRTVAVNLAGVEDSLAKGKIGGKGCQVPGRAIELDVVSDAEAI 85  Methanoco...
Q6LWZ9               6 DKISLYDAKGNLVAENVPLEAISPLYNPTIKSMVKNIKRTVAVNLAGIEGTLAAGKIGGKGCQVPGRTLDISAVSNAQAI 85  Methanoco...
5A8R_B               6 DRIDLYGADGKLLEEDVPLEAISPLKNPTIANLVSDVKRSVAVNLAGIEGSLRKAALGGKSNFIPGREVELPIVENAEAI 85 
1HBM_B              85 AAAAKEMIQV-TEDDDTNVELLGGGKRALVQVPSARFDVAAEYSAAPLVTATAFVQAIINEFDVSMYDANMVKAAVLGRY 163
AGN26874            84 AAKVKEYVKVdSSDDDTDVRVFSEGKNMIVIVPSRRMDAGVEYTTGFTTTAAAVTQAIIDEFDVDMFHANMVKGAVWGRY 163 Candidatu...
licsiro:TALC_00469  85 AKDIKAMVQV-TEDDGTQVIVKDGGKSLTVIVPEARTDAGIEYTTGFTTVAAATTEAIIDRYKVPMYKANMVKAAVWGRY 163 Thermopla...
Q2NI03              86 ADKIEKMLKI-SDDDDFNLNLLNGGKQILVQVPSERLSIAGDYSVAPLATGSALIQAILDTFDINKYQASEIKTAAMGGY 164 Methanosp...
CDG65901            86 AAKIEKMIRV-DEEDDFNLKLINKGQQLLVQLPSQRMKMAGDYTVSTMVTGSAVVQAIIDTFDVDKFDASAIKTAVLGQY 164 Methanoba...
Q58252              89 AEYVEKVVRV-SEDDDTSIKLINDGKQMAVQIPSKRLDVAAEYSVSVLVTAQALKEAIIRTFDVDIFDAPMVHAAVLGGY 167 Methanoca...
jgi:Maeo_1264       86 MDKVEKILKI-SEDDDTNIRTINGGKQAVVQVPSKRLDIAAEYSVSMLSTGMALKEAIIDTFDVDMFDGSTVHAAIVGRY 164 Methanoco...
jgi:Mvol_1124       86 ADKVKSILQV-SAGDDTEVKLINGGKQMAVQVPTKRLDVAAEYSVSMLATGMALKEAIITNFNVDMFDGSTVHSAIMGQY 164 Methanoco...
Q6LWZ9              86 ADEVEKILKV-SEDDDTAVKIINGGKQLAVQVPTARLDVAAEYSVSMLSTAMALKEALIKTFNIDMFDGSTVHAAIVGNY 164 Methanoco...
5A8R_B              86 AEKVKKLVQT-SEDDDTNIRLINNGQQILVQVPTTRMGVAADYTVSALVTGAAVVQAIIDEFDVDMFDANAVKTAVMGRY 164
1HBM_B             164 PQSVEYMGANIATMLDIPQKLEG 186
AGN26874           164 PQTLNFVGSNLTSILDVPQVNEG 186 Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
licsiro:TALC_00469 164 PQTINFVGSNIKSILEVPQNNEG 186 Thermoplasmatales archaeon BRNA1
Q2NI03             165 PHNVKL-GGALTTLLGQTTHLEG 186 Methanosphaera stadtmanae DSM 3091
CDG65901           165 PQTVDFSGANVSALLGPPQMLEG 187 Methanobacterium sp. MB1
Q58252             168 PHEVTMKGSNIAALLGSPLSLEG 190 Methanocaldococcus jannaschii DSM 2661
jgi:Maeo_1264      165 PQVMDYMGGNIASLLGAPSNMEG 187 Methanococcus aeolicus Nankai-3
jgi:Mvol_1124      165 PQDMDYAGGNIASLLGAPSKLEG 187 Methanococcus voltae A3
Q6LWZ9             165 PQVMDYAGGNIASLLGAPSMMEG 187 Methanococcus maripaludis
5A8R_B             165 PQTVDFTGANLSTLLGPPVLLEG 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap