1QKI


Conserved Protein Domain Family
G6PD_C

?
pfam02781: G6PD_C 
Click on image for an interactive view with Cn3D
Glucose-6-phosphate dehydrogenase, C-terminal domain
Statistics
?
PSSM-Id: 397074
Aligned: 427 rows
Threshold Bit Score: 228.089
Threshold Setting Gi: 432857371
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QKI_E       211 MVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTNSDDVRDEKVKV 290 human
O59812       187 TAIRFANSMFEPIWNREHIESVRVDFREDFGCEGRGGYFEGAGILRDVVQNHLLQLLTLLCIEEPKSQDAEDIIKCKVDF 266 Schizosaccharom...
Q93ZW0       338 TVLRFSNLVFEPLWNRTYIRNIQVIISESIAQT--EKFSDGYGIIRDIVHSHILQTIALLAMEPPISLDGEDIRNEKVKV 415 thale cress
EER92354     337 TVLRFSNLVFEPLWSRTYIRNVQVIFSEETSNEIQGRYFGNYGIIRDIVHSHILQTIALFAMEPPVSLDGEDIRDEKVKV 416 sorghum
EFJ19385     202 SVLRFSNLVFEPLWSRKYIRNVQIVFAEDFGTEGRGGYFDRYGIIRDIMQNHLLQIVALFAMEPPVSLDAEDVRNEKVKV 281 Selaginella moe...
XP_002953022 287 TVLRFSNLVFEPLWSRQYIRNVQIVFSENFGTEGRGGYFDQYGIMRDVIQNHLLQILALFAMEPPVSLAAEDIRNEKVKV 366 Volvox carteri ...
XP_002508505 251 TVLRFSNIMFQPLWSRAYIRNVQICFSENFGTEGRGGYFDNYGIIRDVMQNHLLQVMALFAMEEPASLDAEDIRDEKVKV 330 Micromonas commoda
XP_013628826 296 SVLRFSNLIFEPLWSRQYIRNVQFIFSEDFGTEGRGGYFDHYGIIRDIMQNHLLQILALFAMETPVSLDAEDIRNEKVKV 375 Brassica olerac...
XP_009382478 325 TVLRFSNLVFEPLWSRTYIKNVQVIFSEECGMEAQGRYFGHYGVIRDIVHSHILQTIALFAMEPPVSLDGEDIRNEKVKV 404 wild Malaysian ...
XP_006344803 306 AVLRFSNLVFMPLWNRSYIHNIQVTFSEELGMQTSARYPKGYGILGDVVHSHIFQTVALLAMEPPVTLDGEDVRHEKVKV 385 potato
1QKI_E       291 LKCISEVQAnnvVLGQYvgnpdgegeatKGYLDDPTVPR--GSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEV 368 human
O59812       267 LKSLHPVSKediVYGQYtksa---ngkvPGYRELDGVAD--DSEVSTFCALQLRSEAPRWKGIPIIISAGKGLDRDYFEA 341 Schizosaccharom...
Q93ZW0       416 LRSIRKIDPrdvILGQYkss----------srDKNGVIL--NGVDPTYCAAALYIDNARWDGVPFLVRVGTGLIKHRVEI 483 thale cress
EER92354     417 LRSIRKVDLedvVLGQLkdt-------------sgKVDRytKSMTPTYFAAAMYIDNARWDGVPFLIRTGMGLMTNRAEI 483 sorghum
EFJ19385     282 VRSMRPLSIedtAVGQYkgysk-dgvrfPGYTDDSTVPK--NRITPTFAAAALFIDNARWDGMPFLMKAGKALQTRRTEI 358 Selaginella moe...
XP_002953022 367 LRSMRPVQLddtVLGQYrsrqh-ggrtlPGYLDDKTVPP--GSLTPTFAACAMFINNARWDGVPFLLKAGKALHTRRAEI 443 Volvox carteri ...
XP_002508505 331 IRCIRPIEMdnvVLGQYkgrrd-gdkqlPGYLDDETVPP--GSKCPTFAAMALFIDNARWDGVPFLMKAGKALHKRQAEI 407 Micromonas commoda
XP_013628826 376 LRSMRPIQMedvVIGQYkshtk-ggvthPGYTDDKTVPK--DSLTPTFAAAALFIDNARWDGVPFLMKAGKALHTRRAEI 452 Brassica olerac...
XP_009382478 405 LRSIRKLNLddvVLGQYkn-----------saDKSSCYM--NSLTPTFFAAALYIDNARWDGVPFLVKTGVGLIKHRVEI 471 wild Malaysian ...
XP_006344803 386 LKSIRKLGSsdvILGHSead------sgSNFKDME-------NLMPTYFGAVLHIDNARWDGVPFLIKAGRGLKKNRVEI 452 potato
1QKI_E       369 RLQFHDVAGDIFhqqC-------KRNELVIRVQPNEAVYTKMMTKKPGMffnpeESELDLTYGNryknvkLPDAYERLIL 441 human
O59812       342 RITFKRREGGMFptvD-------SSNVLVLRVYPKEFIALKGHIKQPGFsrqivpVTLDVKYPEafpdtwihkAYEVVIA 414 Schizosaccharom...
Q93ZW0       484 HVQFRHVPGNLYr-eNiginidlGTNELILRDEPDEAILVKINNKVPGLglqldASELNLLYKDryk-teVPDSYEHLIH 561 thale cress
EER92354     484 RIQFRHVPGNIYr-eRfghdidlDTNELVLRDQPEEAILLKVNNKVPGLglqldASELNLLYRDryntevVPDSYEHLLL 562 sorghum
EFJ19385     359 RVQFRHVPGNLFk-wNl-----gI---LFKRNSPDEAIYLKINNKVPGLgmrldRSTLDLLYADrys-keIPDAYERLLL 428 Selaginella moe...
XP_002953022 444 RVQFRHVPGNLYk-hKfgpdldsATNELVIRIQPKEAIYLKVNNKVPGLglrldTTRLDLQYQSafsqkeLPDAYERLLL 522 Volvox carteri ...
XP_002508505 408 RIQFHHAPGKLYk-kQlgsasemNSNELVIRIQPDESIYLRLNSKIPGLgmrldQTDLDLQYKTkfseanLPDAYERLIL 486 Micromonas commoda
XP_013628826 453 RVQFRHVPGNLYn-rNtgcdldkATNELVIRVQPDEAIYLKINNKVPGLgmrldRSNLNLLYSArys-keIPDAYERLLL 530 Brassica olerac...
XP_009382478 472 RIQFHHVPGNLYr-eCishnidlTTNELILRDQPDEAILLKVNNKVPGLglqldASELNLLYRDkyn-veVPDSYEHLLL 549 wild Malaysian ...
XP_006344803 453 RIQFRRVPGNIYhkdGgghmqdlVTNELILRDVPDEAILIRINNKIPGLgmnleASELNLLYKDkyn-vdVTDSYEQLLH 531 potato
1QKI_E       442 DVFCGSQMHFVRSDELLEAWRIFTPLLHQIeLekpkPIPYIYGSR-GPTEADELMKRV--Gfqye--gtykW 508 human
O59812       415 DAINGKHTHFISDDEVRTSWKIFDDVLDTTgDl--sPLPYAFGSHhGPDATLEFFKKRnlE----------W 474 Schizosaccharomyces pom...
Q93ZW0       562 DVIDGDNHLFMRSDEVAAAWNILSPVLEEIdKhhtaPELYEFGGR-GPVAAYYLWAKH--Gv--------pW 622 thale cress
EER92354     563 DVLDGDSHLFMRSDELAAAWNVLTPIIHEIdQnrvaPELYEAGDR-GPINAYYLAAKH--Gv--------rW 623 sorghum
EFJ19385     429 DAIAGERRLFVRSNELDAAWKIFTPLLKDLeRkktaPELYPYGSR-GPVGAHYLATKH--NvkcrkalilkY 497 Selaginella moellendorffii
XP_002953022 523 DVVNGDKRLFIRYDELEAAWELFTPLLHEIeSrkvaPELYPYGSR-GPVGAHYLAAKY--Nv--------rW 583 Volvox carteri f. nagar...
XP_002508505 487 DVVQGDKRLFIRNDELEEAWKLFTPLLKTIeDdqmaPELYPYGSR-GPIGAHYLASRY--Nv--------rW 547 Micromonas commoda
XP_013628826 531 DAIEGERRLFIRSDELDAAWSLFTPLLKEIeEkkriPEYYPYGSR-GPVGAHYLAAKH--Kv--------qW 591 Brassica oleracea var. ...
XP_009382478 550 DVIDGDNHLFMRSDELEAAWNILTPILDKIeEnkvvPELYEIGGR-GPVGAYYLGANH--Gv--------rW 610 wild Malaysian banana
XP_006344803 532 DVIDGDNHLFMRSDEVEAAWNILSPVLSELdNnnatLEHYEFGSK-GPDKAGNLWAKH--Gv--------kW 592 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap