5I82,5I82


Conserved Protein Domain Family
Diphtheria_C

?
pfam02763: Diphtheria_C 
Click on image for an interactive view with Cn3D
Diphtheria toxin, C domain
N-terminal catalytic (C) domain - blocks protein synthesis by transfer of ADP-ribose from NAD to a diphthamide residue of EF-2.
Statistics
?
PSSM-Id: 397059
Aligned: 2 rows
Threshold Bit Score: 407.238
Threshold Setting Gi: 1002351821
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5I82_D   1 GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKEFYSTDNKYDAAGYSVDNENPLSGKAGGV 80  Corynebacterium dipht...
5I82_D   1 GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKEFYSTDNKYDAAGYSVDNENPLSGKAGGV 80  Corynebacterium dipht...
5I82_D  81 VKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALS 160 Corynebacterium dipht...
5I82_D  81 VKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALS 160 Corynebacterium dipht...
5I82_D 161 VELEINFETRGKRGQDAMYEYMAQACA 187 Corynebacterium diphtheriae
5I82_D 161 VELEINFETRGKRGQDAMYEYMAQACA 187 Corynebacterium diphtheriae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap