6BK5


Conserved Protein Domain Family
Cbl_N2

?
pfam02761: Cbl_N2 
Click on image for an interactive view with Cn3D
CBL proto-oncogene N-terminus, EF hand-like domain
Cbl is an adaptor protein that binds EGF receptors (or other tyrosine kinases) and SH3 domains, functioning as a negative regulator of many signaling pathways. The N-terminal domain is evolutionarily conserved, and is known to bind to phosphorylated tyrosine residues. The so called N-terminal domain is actually 3 structural domains, of which this is the central EF hand domain.
Statistics
?
PSSM-Id: 397057
Aligned: 25 rows
Threshold Bit Score: 108.093
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6BK5_A       161 FTIVKIDAREFWHRQFGKRLVVPWSELVPIMQAELGLSEKE--GPALQHTMDITENNHVSWFEFDVFTRLFQPWSQLINN 238 Salpingoeca ros...
2_pfamImport   1 FRITKSDAAEFWRNNFGNSTADPIKVCRTEYPQLQKMESIL--RGLIEIFVKIASSGFLKSTAY-TFLLLFQPWTSLLRN 77 
CCD82614     130 FRITKPNAARWWLSNFGDSVVVSWQLFKDSLIQTFRIDSDTq-LLALQTTIDITCNDYVSIFEFDVFTRLFQPWNNILET 208 Schistosoma man...
CDS37021     177 FRITKREAAEWWHENFGESSIVSWEVFRTRLFATFGVLDCNe-TRELQNTIDLTCNNYVSVFEFDVFVRLFQPWTNVLET 255 Echinococcus mu...
ESN90703     107 FRVTKNDADEWWKSAFQDKIIIQWKQFRQSFSEVHRIDSAIe-WVALKSTIDLTLNDHISIFEFDVFTRLFQPWRTLLSN 185 Helobdella robusta
XP_009026767  19 YRITKNDASDWWKSVFKKRTLVTWKEFKLAFNQVHKVGTSKe-SDALKTTLDLSCDEHISIFEFDIFTRLFQPWRTLLCN 97  Helobdella robusta
PDM60022     172 FRLTKREADAFWKTSFKARICVPWAEFIVALAESQRIPENV--KNNLKCTIDLTCNDYVSMFEFDVFTRLFYPWKSLIEN 249 Pristionchus pa...
5_pfamImport   1 FRITKKEAESFWSHHFPKKNIVPWPTFLSAIEKYHGMPIEKlqAGDLKATIDLSADDYISSFEFDVFTRLFYPFKNLIKN 80 
XP_004364071 198 lKIAKKEAADFWKANFDLRCIVPWHEFLAAFKTVHPISTPQe-ASALRTTMNLTDYNHISWFEFDVFTRLFQPWSHLVNN 276 Capsaspora owcz...
Q6ABG8       170 FRMTKKEAESFWSHHFTKKNIVPWSTFFTALEKHHGSTIGKmeAAELKATIDLSGDDFISNFEFDVFTRLFYPFKTLIKN 249 Caenorhabditis ...
6BK5_A       239 WYVLA 243 Salpingoeca rosetta
2_pfamImport  78 WQILA 82 
CCD82614     209 WKALA 213 Schistosoma mansoni
CDS37021     256 WKALT 260 Echinococcus multilocularis
ESN90703     186 WNLLA 190 Helobdella robusta
XP_009026767  98 WNVLA 102 Helobdella robusta
PDM60022     250 WKLLT 254 Pristionchus pacificus
5_pfamImport  81 WQTLT 85 
XP_004364071 277 WNVLA 281 Capsaspora owczarzaki ATCC 30864
Q6ABG8       250 WQTLT 254 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap