1E6V


Conserved Protein Domain Family
MCR_alpha_N

?
pfam02745: MCR_alpha_N 
Click on image for an interactive view with Cn3D
Methyl-coenzyme M reductase alpha subunit, N-terminal domain
Methyl-coenzyme M reductase (MCR) is the enzyme responsible for microbial formation of methane. It is a hexamer composed of 2 alpha (this family), 2 beta (pfam02241), and 2 gamma (pfam02240) subunits with two identical nickel porphinoid active sites. The N-terminal domain has a ferredoxin-like fold.
Statistics
?
PSSM-Id: 397045
Aligned: 14 rows
Threshold Bit Score: 511.986
Threshold Setting Gi: 502959390
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E6V_A          6 EKLFMKALKEKFE-E-SPEEKYTKFyIFGGWKQSERKKEFKEWADKIVEER-GVPHYNPdI----GVPLGQRKLMSYQVS 78  Methanopyrus k...
A0B6N6          7 KKLFVRALTKKFGkDfDLSSQKTEY-KRLGPEQSARKREFMEYSKKLEGKR-GISFYNP-YlhcgGVPLGQRQLVPYKLS 83  Methanothrix t...
Q8THH1         14 EVKFTQEYGSNKQaGgDITGKTEKF-LRLGPEQDARKQEMIKAGKEIAEKR-GIAFYNP-Mmh-mGAPLGQRAITPYTIS 89  Methanosarcina...
WP_013194366   15 ERKFTQEFGDNKQsGgEITDKKTEY-QRMGVAQSPRKMEMLKAGQELSKKR-GLVGYNP-DlhagGVQLGQRALTPSYLS 91  Methanohalobiu...
WP_013898158   14 eIKFTKEFGDNKQsGgSITDTRNKY-HRLGVDQDPRKREMREAGQKVAKER-GLVGYNP-MmhcgGIPLGQRAITPSFVS 90  Methanosalsum ...
jgi:Mfer_0784   6 KKLFVDALRKKFK-E-EPKERKTTFyTLGGWKQSERKKEFVEYGKKVAKER-GIPAYNPdI----GTPLGQRVLMPYQVS 78  Methanothermus...
WP_016359092    3 dKKFYEALNKKFK-E-SPEDKTTTFyNLGGWKQSERKTQFYEAGKEIAEER-GIPMYNPdI----GSPLGQRTLMPYQLS 75  Methanobreviba...
AGN26871        3 DKLFMDAMKKKFK-E-DPTDEYTSYyTFGGWKQSKRKREWVEQANAIAKAR-GIPMMNQdI----GVPLGQRVLMPYQLS 75  Candidatus Met...
WP_011833928    8 QKLFLDALKQKFPkQ-DVASTTAEFyKFNGLEQSPRKREFMAENKKIEAAR-GISMYDPnRchlgGIPMGQRQLMTYELS 85  Methanocorpusc...
Q58256          5 KRLFLKALKEKFE-E-DPREKYTKFyVFGGWRQSARKREFVEAAQKLIEKRgGIPFYNPdI----GVPLGQRKLMPYKVS 78  Methanocaldoco...
1E6V_A         79 GTDVFVEGDDLTFVNNAAMQQMWDDIRRTVIVGMDTAHRVLERRLGKEVTPETINEYMETLNHALPGGAVVQEHMVEIHP 158 Methanopyrus k...
A0B6N6         84 NTEYIVEGDDLHFVNNPAMQQMWDDIRRTVVVGLDMAHEVLEKRLGKEVTPETINNYLEILNHAMPGAAVVQEHMVETHP 163 Methanothrix t...
Q8THH1         90 GTDIVAEPDDLHYVNNAAMQQMWDDIRRTCIVGLDMAHETLEKRLGKEVTPETINHYLETLNHAMPGAAVVQEMMVETHP 169 Methanosarcina...
WP_013194366   92 GTDMLTEMDDLHYVNNAAMQQMWDDIRRTCIVGMDSAHETLEKRLGIEVTPETINHYLEVLNHAIPGGAVVQEHMVETHP 171 Methanohalobiu...
WP_013898158   91 GTDIMVEPDDLHYVNNAAMQQMWDDIRRTCIVGLDMAHETLEKRLGMEVTPETINHYLEVLNHALPGGAVVQEYMVETHP 170 Methanosalsum ...
jgi:Mfer_0784  79 TTDTFVEGDDLHFVNNAAMQQFWDDIRRTVIVGLNHAHRILERRLGKEVTPETINHYLETVNHAMPGAAVVQEHMVETHP 158 Methanothermus...
WP_016359092   76 TTDTFVEGDDLHFINNAAIQQLWDDIRRTVLVGLNTAHNVLQRRLGMEVTPETITNYLETVNHAMPGAAVVQEHMVETNP 155 Methanobreviba...
AGN26871       76 HTDMYAEADDLHFVNNAAIQQAWDDIRRTVIVGLDTAHTVIEKRLGKEVTPETINNYLETVNHAMPGGAVVQEHMAECSP 155 Candidatus Met...
WP_011833928   86 GTGTFVEGDDLHFVNNAAMQQMWDDIRRTVIVSMDMAHQTLQKRLGKEVTPETINEYLHVVNHAMPGGAVVQEHMVETHP 165 Methanocorpusc...
Q58256         79 NTDAIVEGDDLHFMNNAAMQQFWDDIRRTVIVGMDTAHAVLEKRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHP 158 Methanocaldoco...
1E6V_A        159 GLTWDCYAKIITGDLELADEIDDKFLIDIEKLFPEEQAEQLIKAIGNRTYQVCRMPTIVGHVCDGATMYRWAAMQIAMSF 238 Methanopyrus k...
A0B6N6        164 GLVEDCNVRVFTGDDDLADEIDPQYLIDINKLFPADQAEQLKAAIGKTTWQAIHIPTIVVRSCDGGTTSRWSAMQLSMTF 243 Methanothrix t...
Q8THH1        170 ALVDDCYVKIFTGDDELADEIDKQYVINVNKMFSEEQAAQIKASIGKTTWQAIHIPTIVSRTTDGAQTSRWAAMQIGMSF 249 Methanosarcina...
WP_013194366  172 GLTEDCYVKIFTGDDDLADEIDDQFLIDIDKEFPEDQAQQLKESIGKTTWQVAHIPTVVSRTTDGGQTRRWMAMQLGMSF 251 Methanohalobiu...
WP_013898158  171 ALVDDCYVKIFTGDDDLADEIDKQFLIDINKEFPEEQAEQLKKSIGKTTWQAAHIPTIVSRTTDGGQTSRWIAMQVGMSF 250 Methanosalsum ...
jgi:Mfer_0784 159 GLTADSYVKVFTGNDELADEIESCYLIDINKQFPEHQAEQLKKAIGDSIWQAVRIPTIVSRTCDGATTSRWSAMQIGMSM 238 Methanothermus...
WP_016359092  156 YLVSDSYVKIFTGDDELADEIDQCYVLDINKEFPDDQAAQLKAEVGDKIWQVVRVPSLVGRVCDGGTTSRWSAMQIGMSM 235 Methanobreviba...
AGN26871      156 ALTADCYVKVFSGNSELIDQLDKRFVIDINKEFPEDQAKQLNDAIGKSLYQVVRCPTIVGRVCDGGTMSRWSAMQISMSF 235 Candidatus Met...
WP_011833928  166 GLTDDCYVRVFTGDQELADNLEPQFVIDVEKLFPKKQAEALQAAVGKSLWQCVHMPTIVGRTCDGGTTSRWSAMQIGMSF 245 Methanocorpusc...
Q58256        159 ALVWDCYAKIFTGDDELADEIDKRFLIDINKLFPEEQAEQIKKAIGKRTYQVSRVPTLVGRVCDGGTIARWSAMQIGMSF 238 Methanocaldoco...
1E6V_A        239 ICAYKIAAGEAAVSDFAFASKHAEVINMGEMLP 271 Methanopyrus kandleri
A0B6N6        244 IDAYNMCAGEAAVADLAYAAKHAAVLQMSDMLP 276 Methanothrix thermoacetophila PT
Q8THH1        250 ISAYAMCAGEAAVADLSFAAKHAALVSMGEMLP 282 Methanosarcina acetivorans C2A
WP_013194366  252 INAYHMCAGEAAVADLSYAAKHASVINMGEMLP 284 Methanohalobium evestigatum
WP_013898158  251 ISAYNMCAGEAAVADLSYSAKHAAVVSMGDMLP 283 Methanosalsum zhilinae
jgi:Mfer_0784 239 ISAYKQAAGEAATADFAYAAKHAEVIHLGTFLP 271 Methanothermus fervidus DSM 2088
WP_016359092  236 ISAYNQCAGEGATGDFAFATKHAEVIQMGAPLP 268 Methanobrevibacter sp. AbM4
AGN26871      236 ISAYRLAAGEAAIADFAYAAKHASVVEMGTMMP 268 Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
WP_011833928  246 IAAYRMCAGEAAVADLSFAAKHAGVINMAHHLP 278 Methanocorpusculum labreanum
Q58256        239 ITAYKLCAGEAAIADFSYAAKHADVIQMASFLP 271 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap