4O6J,2X4H


Conserved Protein Domain Family
Fe_dep_repr_C

?
pfam02742: Fe_dep_repr_C 
Click on image for an interactive view with Cn3D
Iron dependent repressor, metal binding and dimerization domain
This family includes the Diphtheria toxin repressor.
Statistics
?
PSSM-Id: 397042
Aligned: 407 rows
Threshold Bit Score: 41.3178
Threshold Setting Gi: 148569786
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4O6J_A            87 TPSGDREANRFLRKHRTAEILLSRCIGIPWERVDEEAMGIEHGMTEEIIQRTIERFGV-DRCPHGNPIPD 155 Thermoplasma acidophi...
NZAGRC:Abm4_0703  67 TKEGSKIAQKITRKHRILELFLRNDLKIKPENVHEQACEMEHSLSDEAERALCQRLHQpDVCPEGSLIPA 136 Methanobrevibacter sp...
WP_012618300      63 TGDGRTIATTIKRRHRLLEVFLTDILHINREKVHDEACRMEHTISGETEDALCRLLEApARCPHGSPIsp 132 Methanosphaerula palu...
WP_015284812      63 TEQGREMARKVKRRHRLLEVFLTDVLHITRENVHDEACKMEHTLSDETECALCKLLNApARCPHGSLIea 132 Methanoregula formicica
Q03TT4            61 TDQGRELATRLLYKYRLCEVFLAQHLHLPLSQIPEQAWQMADTLEPPTVTALATFLDHpQQSPFGGDMtt 130 Lactobacillus brevis ...
O27019            72 TDEGREIAEMVLRRHMILECFFHNVLGMDLDSSYEEASRMKHELFRETELALMRYLRNpARCPHGIPIP- 140 Methanothermobacter t...
Q8TI19            67 TEKGAEEAVRIKRKHQVLETFLADVLDFDRKEAHREACELEHAVSDSVLERLYDFLGNpEYCPDGHPINi 136 Methanosarcina acetiv...
Q0W4R0            63 TEEGRAEAIRMERKHQLLETFLVGTLGVDTDTAHDEACELEHSVSDNTMERICSYLGHpRYCPDDHPITK 132 uncultured methanogen...
BAI60283          63 TEKGRAEAVQMERKHQLLETFLVDTLGVELNKAHEEACEMEHAVSDSTVSKICSFLGHpKFCPDDHPITS 132 Methanocella paludico...
AGN26415          54 TEKGFEYAKHLREKHQVMERFLVDVLDANEDVAHEEACRTEHVISDESAGRMCKILGTnEHCGCGCSIqc 123 Candidatus Methanomas...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap