1LPA


Conserved Protein Domain Family
Colipase_C

?
pfam02740: Colipase_C 
Colipase, C-terminal domain
SCOP reports duplication of common fold with Colipase N-terminal domain.
Statistics
?
PSSM-Id: 397040
Aligned: 10 rows
Threshold Bit Score: 74.7813
Threshold Setting Gi: 189082686
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LPA_A        46 NSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHN 89 
XP_006628563  64 NEECSPKSLYGTYYRCTCESGLKCDVNFNIGGSITNSNFGICVD 107 spotted gar
XP_005059492  67 fQECSPKSIYGVYYKCPCERGLTCKADKTIVGSITNSNFGVCKD 110 Collared flycatcher
XP_003403998  64 NSECSTKSIYEVYYKCPCESGLTCNANKTLVGSLTNTNFGICQD 107 African savanna elephant
XP_003769031  63 NSECSAKTLYGVYYKCPCERGLTCEVDKTIVGSITNTNFGICHD 106 Tasmanian devil
XP_009240066  22 RGIIINLTLYGIYYKCPCERGLTCEGDKTIVGAITNTNFGICHD 65  Sumatran orangutan
EGW03619      64 NSECSPKTIYGIYYRCPCERGLTCEGDKTILGAITNTNYGICLD 107 Chinese hamster
ACB54899      65 TQDCSRKSLYGVYYKCPCESGLSCDADWSIVGSITNTDYGVCYD 108 chicken
A9JSD6        68 TQKCSPLHIYGTYYFCPCESGLTCEVDRSIVGSITNTDYGYCED 111 tropical clawed frog
XP_004176718  49 SQECSPKNLHGVYYKCPCETGLSCDANRTIVGTITNRNFGVCRD 92  zebra finch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap