Conserved Protein Domain Family
DUF223

?
pfam02721: DUF223 
Domain of unknown function DUF223
Statistics
?
PSSM-Id: 145722
View PSSM: pfam02721
Aligned: 15 rows
Threshold Bit Score: 68.8613
Threshold Setting Gi: 116831073
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZQL0 310 AVSINQEKVv----fDKMQIKLDNEIVKRLD---------DKLLesKASMKKMSIAVIWMDSKSYRheeiQKVRKGRFFR 376 thale cress
Q9ZQM7 383 ETVVASHSGvcevniDPMKVYINNKYHTFLAmvvfgkpvfDISS--KADKDPQSSPTHSSNSGAIR----TTHEFRILFM 456 thale cress
Q9SIG4  39 RLLLVDKLG------TQIEATIGPRFSAFYY---------DRIK--ENQWKTITTFIVRPNCEAIRt---TPHEFRILFM 98  thale cress
O65701  39 RLVLADEWG------TQIEATIGPRFSAFYF---------DRIK--ENQWKTITTFLVRPNCEAIKt---TPHQFRILFM 98  thale cress
Q9LTN7  38 RVVFVDEWG------IQIEAIIGSRFSQRYY---------NMLE--ENQWKEIRTFGVIENCGFVRt---TTHKYMIEFM 97  thale cress
O65232   2 GLILADEHG------MTIEATVGYKMSDHYK---------DFIN--EGEWVTITNFGVVENSGSVRa---TTHSFKIGFS 61  thale cress
Q9LH11  39 GLVLADEHG------VTVDAMIEKEFADYDN---------EFID--AGDWITIMRFGVYPNSNPVRv---TCHKFKICFF 98  thale cress
Q9MBH0  44 EMILVNEVG------DKMYAPVRREQIEKIE---------RCLT--EGVWKIITTITLNHTSGQYRi---SDLKYKIGFV 103 thale cress
Q9FHV9  42 DVIICDENG------SKMHITIRKHYIGKFH---------RSIK--VGDWKIIDNFTLSPLTGKYKi---SSLTYRMAFN 101 thale cress
Q2HSY3  43 ELVLIDRKG------DRIGASIRRTLIYKFK---------NQLQ--EGMVFTISSFNVASNIGSYRp---SRNEYKLNFT 102 barrel medic
Q9ZQL0 377 TKEQLTSADTRPTVQ-FNNLTRFDYILEETYDTEVL 411 thale cress
Q9ZQM7 457 EQTAVTSSTTRETIL-LNNFTPFDYIVENTVPKDTL 491 thale cress
Q9SIG4  99 EQTVVTPSTTKETVV-LNNFTPFDYIIEDTVRKYTL 133 thale cress
O65701  99 DHTIVTSSTPRETGL-LNKFTPFDYIVDDVVGNDTL 133 thale cress
Q9LTN7  98 NATELNHSDPRENVL-FNRFTPFDYIIEDTAHTENL 132 thale cress
O65232  62 VDTVVKLTSPVHAIP-HYRLASFSSIIDDEIDKSVL 96  thale cress
Q9LH11  99 KDTVVRKTTVVVANP-HYTLTYFSSIIDDEIDTSVL 133 thale cress
Q9MBH0 104 FKTTVSPCDTVFDAL-FLSLAKFDVILSGSANSNIL 138 thale cress
Q9FHV9 102 HNTDVIKCDPVSDSV-FLDLADFEGVKTESYDENVL 136 thale cress
Q2HSY3 103 INTKVKLSKTVLVPTnVYSFTPAPNVFNESYDNNYL 138 barrel medic
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap