5E5Q


Conserved Protein Domain Family
GASA

?
pfam02704: GASA 
Gibberellin regulated protein
This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Statistics
?
PSSM-Id: 397016
Aligned: 77 rows
Threshold Bit Score: 49.1443
Threshold Setting Gi: 75137702
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5E5Q_A         4 FCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHEC-PCYRDKKNSKGKS-KCP 63 
XP_009410274  56 ECGDACKDRCKLHSRQNVCSRACITCCSVCKCVPPGTYGHTELCgKCYTDWKTHGNRT-KCP 116 wild Malaysian banana
XP_004975888  50 DCGGACDVRCGAHSRKNRCTRACLKCCSVCRCVPAGTAGNQETCgKCYTDWTTHGNRT-KCP 110 foxtail millet
XP_006652386  46 DCLGACDVRCSEQKRKNLCSRACLKCCSVCLCVPAGTSGNKETCgRCYTDWATHGNRTnKCP 107 malo sina
CAD40932      45 DCVGACDARCSEHSHKKRCSRSCLTCCSACRCVPAGTAGNRETCgRCYTDWVSHNNMT-KCP 105 Japanese rice
Q9LFR3       215 DCVPLCGTRCGQHSRKNVCMRACVTCCYRCKCVPPGTYGNKEKCgSCYANMKTRGGKS-KCP 275 thale cress
EEF44935     161 gCVPLCEKRCKTHPVKRPCMKVCTACCAKCKCVPPGTTGNLNKC-KNWDYVMLHGYEV-QCP 220 castor bean
KRG93396     138 DCIPLCDYRCSLHSRKKLCMRACITCCDRCKCVPPGTYGNREKCgKCYTDMLTHGNKF-KCP 198 soybean
ERN01700      50 ECPSLCEGRCLLHSRPNHCKRVCKTCCERCRCVPPGTAGNKKMCgKCYTDMTTHGNKL-KCP 110 Amborella trichopoda
XP_002300706  59 DCGGACKDRCSLSSRPHLCNRACGTCCARCKCVPKGTSGNLDTC-PCYATMTTHGGRR-KCP 118 black cottonwood
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap