Conserved Protein Domain Family
KdpD

?
pfam02702: KdpD 
Osmosensitive K+ channel His kinase sensor domain
This is a family of KdpD sensor kinase proteins that regulate the kdpFABC operon responsible for potassium transport. The aligned region corresponds to the N-terminal cytoplasmic part of the protein which may be the sensor domain responsible for sensing turgor pressure.
Statistics
?
PSSM-Id: 397015
Aligned: 241 rows
Threshold Bit Score: 169.122
Threshold Setting Gi: 260865472
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4JUR7                 3 KRGTLKVYLGFAPGVGKTYAMLSEAHDLYDRGRDVLIGIVEDHGRERTRKLT---EGLPTLPRKSVPYRGGHYEELDLEA 79  Coryneb...
jgi:Adeg_1482          4 nGGRLKLLVGIISWPGNTVALLQEGQELLSQGRDVVIGILK-YSDPEIEALS---RTLRSIPP--------LGERLNLPE 71  Ammonif...
BAH41362              21 HRGRLKIILGAVSGAGKTYHLLMEGQTLKKKGIDVVVAGSVEATHPKLAQKR---EGLEQIEPIIWYSLGEAKHDLDVAA 97  Breviba...
jgi:Pjdr2_5993        21 HHGRLKIYIGAVSGAGKTYHMLREGQQLRKQGIDVVTCAVSTMQRPETMEQL---AELERIPSIRWEKDGSQRKDLDLAA 97  Paeniba...
zhongguo:PM3016_1497  20 QRGRLKIYVGPFSGSGKTYHMLQEGNSLKQRGIDVVICAVSTMQRKETIEQI---GCLERVPSIHWVKDGVEKKDLNIEA 96  Paeniba...
WP_013369956          20 HRGRLKIYIGAVSGSGKTYHMLQEGQSLQHEGIDVVICAVSTLQRRETVEQV---GSLERVPSIHWMKDGEEQKDLNVEA 96  Paeniba...
sklacau:PSAB_12625    20 HRGRLKIIIGSVSGSGKTYHMLQEGRLLKERGIDVVCCAVSTMQRTETVQQL---EELDRIPSLHWLKGGKEQKDLPLET 96  Paeniba...
jgi:GYMC10_0435       20 HQGRLKVYIGAVSGSGKTYHMLREGQTLRLQGIDVVICAVSTMQRPETVEQV---RDLERVPSIHWMEDGVEKKDLDLDL 96  Paeniba...
SDU_Lin:LFML04_0561   22 gpGRLKVYLGWAPGVGKSRRALLDLATLKKRGIVPVIGWLEDKGREEIRILA---GEFRSVPPREVVVAGKSFREMDVEA 98  Leptosp...
CCY69978               1 ---mLKIFTSYTPGAGKSYAMMEEAMNESRNGKKVVIAFINKQHRDSSKMPFecnENVTIHPLKGRE---------SIEE 68  Eubacte...
Q4JUR7                80 ALEAHPEIVLVDELAHTvvgenNADSSRPaeaIKRWHDVYALLDAGIDVISTMNIQHLESLNDVVS-AVTG--TRQLETV 156 Coryneb...
jgi:Adeg_1482         72 ILAQRPEVVLVDDAGAL-----YPEDSPY---QARWQEVEEILAAGIDVVATVHALELEGFKEFLPfPLTSplSLSEGII 143 Ammonif...
BAH41362              98 IIERDPEVVLVDGLAHR-----NRSDAPR---PTRLDDVQFLLNNNISVIATVNIYELAGMKEMAE-RLTKaeVRIDQCV 168 Breviba...
jgi:Pjdr2_5993        98 IKARNPEVVLVDGLAHR-----NRPDSLL---PTRLDDIRHLLECGISVITTLNVYELNGVSDLAY-QLTG--IEAEHTV 166 Paeniba...
zhongguo:PM3016_1497  97 LLARNPEVVLVDGLAHR-----NRMEARF---RTRLQDIQHLLKQGISVITTVNVYELEGYTELAQ-RLTG--IEVDETV 165 Paeniba...
WP_013369956          97 LVARNPEVVLVDHLAHH-----NRKDASF---PTRLEDIRYLLEMGISVITTVNVYELEGITEWVY-QLTG--FEAEYTV 165 Paeniba...
sklacau:PSAB_12625    97 LLKRNPEVLLVDGLAHR-----NRKGAQF---ATRLEDIRFLMENGISVITTVNVYELEGVGESIF-KMTG--IRAENTV 165 Paeniba...
jgi:GYMC10_0435       97 LVQRNPEVVLVDGLAHR-----NRKGARH---AARLDDIRFLLSRGISVITTVNVYELADVQDIAS-KLTG--IKASHTV 165 Paeniba...
SDU_Lin:LFML04_0561   99 ILRESPPIVFVDELARD-----NPPVSGR---LSRWEEVGRLLESGISVVTTLNAMHVHELAPTVS-RLLE--RPVEVTL 167 Leptosp...
CCY69978              69 IIEMKPDIVVLDELGMRi--------gKH---TFLYNVAESFIKNNISVLTSANLKRFEEVNPIFR-SETG--VGIKTTI 134 Eubacte...
Q4JUR7               157 PDQVLRDADEIELVDLSPDALRIR---LARGEVYRQQQA-ETALNNYFRVGNLTALRELSLLWLADKV 220 Corynebacterium jei...
jgi:Adeg_1482        144 PASFLDRASEVELVDVTPEELSRQgisLPPG--FDPRSR----LGPYLAAANFAAFRRAVLKRLADEV 205 Ammonifex degensii KC4
BAH41362             169 PEDTLAMADEVKLLDVTPEAILKR---LQE----DDRNP-TRTKHPLFRRDNLHMLRELALRFVATgv 228 Brevibacillus brevi...
jgi:Pjdr2_5993       167 PDDILELADEVRLIDVSPETILTR---LNEGHLRNASSP-H-----LLLRGNLGKLRELALRLMAEDV 225 Paenibacillus sp. J...
zhongguo:PM3016_1497 166 PADTLELADEIRLIDVTPESILAR---LSEGAM-------EATHTSLSKRDNLGKLRELALRLVAEDV 223 Paenibacillus mucil...
WP_013369956         166 PVDTLELADEIRLIDATPEMILER---LAKGYMHTPNPE-------MFHRGNLGKLRELALRLVAEDV 223 Paenibacillus polymyxa
sklacau:PSAB_12625   166 PMDTLELADEVRLIDVSPETILKR---IEEGVLGDVTHP-A-----LSRRGNLAVLRELSLRLVAEGv 224 Paenibacillus sabin...
jgi:GYMC10_0435      166 PADTLESADEVVLIDVTPETMLER---AQGGLLGDGS---------LWKQGNLAVLRELTLRLVAEGv 221 Paenibacillus sp. Y...
SDU_Lin:LFML04_0561  168 PLDFLRKADEIVVVDIPPAELRER---IRKGLVFPPEQI-DRALKGPYREPNLVRLRELTLDFAArvl 231 Leptospirillum ferr...
CCY69978             135 PNRFIKGADEIVFIDREPELMIKD---FKEGKLFGERYMnSRIMNKNFEENTLKTYREISLDylekyn 199 Eubacterium sp. CAG...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap