1U83,1QWG


Conserved Protein Domain Family
ComA

?
pfam02679: ComA 
Click on image for an interactive view with Cn3D
(2R)-phospho-3-sulfolactate synthase (ComA)
In methanobacteria (2R)-phospho-3-sulfolactate synthase (ComA) catalyzes the first step of the biosynthesis of coenzyme M from phosphoenolpyruvate (P-enolpyruvate). This novel enzyme catalyzes the stereospecific Michael addition of sulfite to P-enolpyruvate, forming L-2-phospho-3-sulfolactate (PSL). It is suggested that the ComA-catalyzed reaction is analogous to those reactions catalyzed by beta-elimination enzymes that proceed through an enolate intermediate.
Statistics
?
PSSM-Id: 397000
Aligned: 103 rows
Threshold Bit Score: 215.053
Threshold Setting Gi: 221738653
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U83_A         31 PVRTNKPRETGQSILidNG-----YPLQFFKDAIAG------ASDYIDFVKFGWGTSLLTKD--LEEKISTLKEHDITFF 97  Bacillus subtilis
EKG18638       80 NPRPPKPRTTGVTEI--RGpyysaMGPHYLSDVLHT------MGHQVDGLKFAGGSFALFPEkqLRELIEIAHQHGVYVS 151 Macrophomina p...
EQB56491       66 NPRDPKPRTKSVTEI--RGpyysvMGKRYLEDVLET------MGHYVDGLKFAGGSFSLFPEdkLKELIDLAHQHDVYVS 137 Colletotrichum...
XP_003344795  106 NPRPPKPRKVGVTEI--RGpyysaMGKRYLQDVLET------MGYHIDGLKFAGGSFSLFPEsrLRELIDLAHEHGVYVS 177 Sordaria macro...
EGS20077       55 NTRPPKPRKVGVTEI--RGsyysvMGKRYLKDVLET------MSYNIDGLKFGGGSFSLYPEpqLRELIDLAHEHGVYVS 126 Chaetomium the...
XP_003651023   64 NTRPPKPRKVGVTEI--RGpyysaMGKHYLKDVLETshtpssMGHHIDGLKFAGGSFALFPEdkLRELIELAHEHGVYVS 141 Thermothielavi...
CCT71032       54 NSRPPKPRSVGVTEI--RGpyysvMGKRYLQDVLET------MGHHVDGLKFAGGSFSLFPEdkLKELINLAHEYNVYVS 125 Fusarium fujik...
XP_007822164   67 NARPPKPRKTGVTEI--RGpyysvMGKRYLQDVFDT------MSHQVDGVKFAGGSFSLFHEdkLRELIQIAHENDAYVS 138 Metarhizium ro...
EHY51966       59 NPRTPKPRNRGVTEI--RGpyysaYGKRHLQDVLET------MGYHVDGLKFAGGSFALMPEgaVRELVDLAHQHDVYVS 130 Exophiala derm...
jgi:Htur_2002  12 NDREEKPRTNGITEI--RGpyydpMGPRELRDILET------MGAYVDIYKFSGGSFALMPEdaVRELIEVCHDHDVLVS 83  Haloterrigena ...
1U83_A         98 FGGtLFEKYVSQK------KVNEFHRYCTYFGCEYIEISNGTLPXTNKEKAAYIADFSDE-FLVLSEVGSKDAe------ 164 Bacillus subtilis
EKG18638      152 TGG-WIEHVLAGCggdvgsGVDKYLDKVRELGFDVVEVSTGFLSLPEGDWLRLVERVQERgLRAKPELGIQFGaggdtea 230 Macrophomina p...
EQB56491      138 TGG-WIEHVLTQSap--ltAVDRYLETCKRLGFDVIELSTGFLSLPPSDWLRLVERVQSFnLTPKPEIGIQFGaggdtaa 214 Colletotrichum...
XP_003344795  178 TGG-WIEHILSSSpda-hsAVDKYLSHCKSLGFDVIEISTGFLSLPPDDWLRLINKVHDAgLIAKPEIGIQFGaggdtsa 255 Sordaria macro...
EGS20077      127 TGG-WIEHLLTHPsp--hdIITRYLTKCRSLGFDVIEISSGFLSIPADDWLRLVDLVHSEgLIAKPEIGIQFGaggdtdv 203 Chaetomium the...
XP_003651023  142 TGG-WIEHLLTQSdp--atAIPRYLKKCKALHFDVVEVSTGFLSLPPDDFVRLVERVQAEgLTAKPEIGIQFGaggdtda 218 Thermothielavi...
CCT71032      126 TGG-WMEHVLLQSnp--vwAVDQYLKKCKQLGFDVIEISSGFLSIPQDDWLRVVDKVHSVgLIAKPECGIQFGaggdtea 202 Fusarium fujik...
XP_007822164  139 TGG-WIEHVLTQSdp--taAVDKYIRKCKEVGFDVVEISTGFLSLPQDDWLRLVDRVHEAgLIAKPECGIQFGaggdtka 215 Metarhizium ro...
EHY51966      131 TGG-WMEHVLTQPda--ntVVEKYLRKCKDIGFDVVELSAGFLSFPPDDWLRLVDKVHSMgLKAKPELGIQFGaggdtaa 207 Exophiala derm...
jgi:Htur_2002  84 TGG-FIEHVLIRDy----eQVDRYVEEAADIGFDIVEVSSGFLAIDVDDMVALTELVQDHgLKAKPEINVQFGaggassv 158 Haloterrigena ...
1U83_A        165 --lASR-----------QSSEEWLEYIVEDX-EAGAEKVITEAResGT-GGIcsssGDVRFQIVDDIISSdIDINRLIFE 229 Bacillus subtilis
EKG18638      231 enlEAIgs--------sSDPSKVVTMAKKFV-AAGVERCMIESE--GItENV----KSWRTDVIQAILRE-VPLENVMFE 294 Macrophomina p...
EQB56491      215 adlQSMgs--------qSDPAKVVDLGKRFI-DMGVERIMVESE--GItENV----ASWRTDVIQKILRD-LPMEKVMFE 278 Colletotrichum...
XP_003344795  256 aelESMga--------tADPSKVVNLCRRFVeEGGVERIMIESE--GItENVaggkKGWRTDVVQAILRD-IPQEKVMFE 324 Sordaria macro...
EGS20077      204 aslESVeg-------gtSGPEKVVALGKKFIaQCGVERIMIESE--GItENV----RKWRTDVVRGILEG-LPKENVMFE 269 Chaetomium the...
XP_003651023  219 aelEALsrsgggggggtSDPSKLVELGRRFVdQLGVERVMIESE--GItENV----RAWRTDVVRQVLRG-LPQEKVMFE 291 Thermothielavi...
CCT71032      203 selSSLg---------tSDPSKIIHMGKRFI-DAGVERIMIESE--GItENV----KSWRTDVIQQILRE-LPQEKVMFE 265 Fusarium fujik...
XP_007822164  216 selEELg---------pSDPSKIISAGKRFI-GAGVERIMIESE--GItENV----TKWRTDVIQRILDE-LPAEKLMFE 278 Metarhizium ro...
EHY51966      208 edlEAAg---------tSDPSKVVNLGKKFI-EAGVERMMIESE--GItENV----KTWRTDVIQAILRD-LPLEKVMFE 270 Exophiala derm...
jgi:Htur_2002 159 eelESEt---------tIDPTSAIEEGRRHL-EAGAYKIMVESE--GItEQV----RDWRTDVAFKIADG-LGVENCVFE 221 Haloterrigena ...
1U83_A        230 APNKTLQQGFIQKIGPNVNLaNIPFHDAIALETLRL 265 Bacillus subtilis
EKG18638      295 AADPTVFNWYVREFGVDVNL-FVDHSQIVQLSCLRH 329 Macrophomina phaseolina MS6
EQB56491      279 AADPAVFNWYVREFGVDVNL-FVDHSQIVQLSGLRA 313 Colletotrichum gloeosporioides Cg-14
XP_003344795  325 AADPEVFNWYVREFGTDVNL-FVDHSQIVQLSCLRE 359 Sordaria macrospora k-hell
EGS20077      270 AAEPKVFNWYVREFGADVNL-FVDHSQIVQLSALRE 304 Chaetomium thermophilum var. thermophilum DSM 1495
XP_003651023  292 AAEPRVFNWYVREFGADVNL-FVDHSQIVQLSCLRE 326 Thermothielavioides terrestris NRRL 8126
CCT71032      266 AADPKVFNWYVREFGTDVNL-FVDHSQIVQLSCLRE 300 Fusarium fujikuroi IMI 58289
XP_007822164  279 AADPPVFNWYIREFGVDMNL-FVDHSQIVQLSCLRE 313 Metarhizium robertsii ARSEF 23
EHY51966      271 AADPPVFNWYIREFGIDVNL-FVDHSQIVQLTCLRS 305 Exophiala dermatitidis NIH/UT8656
jgi:Htur_2002 222 AADPEVFEWYIKQFGPKVNL-FVDNSQIVELECMRS 256 Haloterrigena turkmenica DSM 5511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap