3A14,5JC1,4OOE,1R0K,1JVS,5DUL


Conserved Protein Domain Family
DXP_reductoisom

?
pfam02670: DXP_reductoisom 
Click on image for an interactive view with Cn3D
1-deoxy-D-xylulose 5-phosphate reductoisomerase
This is a family of 1-deoxy-D-xylulose 5-phosphate reductoisomerases. This enzyme catalyzes the formation of 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose-5-phosphate in the presence of NADPH. This reaction is part of the terpenoid biosynthesis pathway.
Statistics
?
PSSM-Id: 396991
Aligned: 73 rows
Threshold Bit Score: 107.559
Threshold Setting Gi: 39930856
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3A14_B   6 LVILGATGSIGTQTLDV--LK---KVK-GIRLIGISFHSNLELAFKIVKEFNVKNVAITGD-VEFEDSSINV-------- 70  Thermotoga maritima
Q73K78   6 VVVLGAGGSIGKNSLEI--IR---RFPdRFELAGFSVHSNSGFAKTLLAEFT-----------DAQFVSTKKknsn---l 66  Treponema denticola A...
Q8F146   5 VCLLGASGSVGESTLKV--LR---AHPeKFRLHSFSVHSNLEKAKEIQKEFSPDFICVSSDfADVGVLGNKLgrt----- 74  Leptospira interrogan...
Q7M9M7   1 MILLGSTGSIGQNALSL--AR---DFR--LPVEVLVAGHNLSLLNAQIAEFQPKIIVIADS-SRASELSLPKds------ 66  Wolinella succinogene...
Q9PMV3   1 MILFGSTGSIGVNALKLaaLK---NIP----ISALACGDNIALLNEQIARFKPKFVSIKDS-KNKHLVKHDRv------- 65  Campylobacter jejuni ...
P56139   1 MVVLGSTGSIGKNALKI--AK---KFG--IEIEALSCGKNIALINEQIQVFKPKKVAILDP-SDLNDLEPLGae------ 66  Helicobacter pylori 2...
Q7VIT0   1 MILLGSTGSIGTNALEV--AS---HFD--IPIESLCAGKNITLLNQQIAHYAPKNVCIADK-NDAHKLINGNyk------ 66  Helicobacter hepaticu...
Q6MEL5   4 IAILGSTGSIGKNTLQV--AR---HLKeRIKVVAIAARENIDLLEAQSKEFCPDIIAVFNN-AKAYELQKRLpgk----- 72  Candidatus Protochlam...
O66722   3 LGVLGSTGSVGSQTLQV--YE---NFRdEIELVGILANRASEKLLQQAKKYKPKYVVSYQE-PAKEWLESLPegv----- 71  Aquifex aeolicus VF5
Q7RD47  85 VGIFGSTGSIGTNTLSI--IRecnKIEkKFNVEALYVNKNVEGIYEQAKEFLPKYVCIHDP-SKYEELKKLLeniknynp 161 Plasmodium yoelii yoelii
3A14_B  71 --WKGSHSIEEMLEALKPDITMVAVSGFSGLRAVLASLEHSKRVCLANKESLVCGG 124 Thermotoga maritima
Q73K78  67 khEIDEEAVRRLIEKSKADIVINGIAGSAGLKASVEVIKSGLDLALANKETIVEAG 122 Treponema denticola ATCC 35405
Q8F146  75 qiLYGESSLCELVREPEVEIVITAIVGSVGLRPTIAAITAGKRLGIANKETLVTSG 130 Leptospira interrogans serovar Lai str. 56601
Q7M9M7  67 klLFGEEGIIESLHLAQSSFVLNALVGFLGLRPTLESLRLGKTLALANKESLVAGG 122 Wolinella succinogenes DSM 1740
Q9PMV3  66 --FIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAG 119 Campylobacter jejuni subsp. jejuni NCTC 11168...
P56139  67 -vFVGLEGIDAMIEECTSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSAG 121 Helicobacter pylori 26695
Q7VIT0  67 -lFFGSEGILEMIESSHSHLLLNALVGFAGLKPSFKALQCNKKLALANKESLVNAG 121 Helicobacter hepaticus ATCC 51449
Q6MEL5  73 tvLAGMEGLLAAASYSEADLVISAMTGTMGLQPTIEAIKAGKDVGLANKEALVSGG 128 Candidatus Protochlamydia amoebophila UWE25
O66722  72 kyLKGDEGLKAIIE--ESERLMNAISGIYGIKPAYEVIKAGKTLLASNKESILCLG 125 Aquifex aeolicus VF5
Q7RD47 162 iiLIGNEGMKQICSSNEIDKIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAG 217 Plasmodium yoelii yoelii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap