Conserved Protein Domain Family
Nitrate_red_gam

?
pfam02665: Nitrate_red_gam 
Nitrate reductase gamma subunit
This family is the gamma subunit of the nitrate reductase enzyme, the gamma subunit is a b-type cytochrome that receives electrons from the quinone pool. It then transfers these via the iron-sulfur clusters of the beta subunit to the molybdenum cofactor found in the alpha subunit. The nitrate reductase enzyme, EC:1.7.99.4 catalyzes the conversion of nitrite to nitrate via the reduction of an acceptor. The nitrate reductase enzyme is composed of three subunits. Nitrate is the most widely used alternative electron acceptor after oxygen.
Statistics
?
PSSM-Id: 396988
Aligned: 140 rows
Threshold Bit Score: 182.279
Threshold Setting Gi: 502773795
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
bcmhgsc:HMPREF0733_10321  22 DTLLWGVLPYVTILVLIGGTIWRYRTDQFSWTTRSSQIYESKMLRLGSPLFHYGLAAVFMGHVGGLVVPKMLTDLV-VDD 100 Rot...
WP_013507026               3 dLFFFAIFPYVAVVLAIGATWYRYSRDRYSHSSHSSQFLESPMLYWGSVPWHIAIFLVLAAHLLAFLFPAAWATLAgRPL 82  Des...
Q1QHX3                     3 DVFLFSVVPYLAIGVAVVGGVYRYRNNRFSYSTLSSQLLENRRLFWGSVPWHYGIVVVLFAHLIGFLVPGMWASLTaTPT 82  Nit...
Q2IJW0                     3 DTFLFAVFPYLATVFAVGGAIYRRRALGGSVSARSSQLIEGRALRWGSIAWHHGILAILAAHLIAAVAPGAWGRLLgAPA 82  Ana...
Q39WW0                    34 DYLFFGVFPYVALVVAVGGGVYRYAKERFSFSSLSSQFLENRALFWGSVAWHYGIVLVLLAHLAALLLPASWGRLLgDPL 113 Geo...
WP_012964841               3 DTLIFVVLPYAAIALALFVTPYRYFKNRLDWSAFSTQFLERRKLYWGSIPWHYGVVIVLAGHLIGFLFPSAVQSALsNFS 82  Fer...
WP_012470699               3 NTLVFVILPYVALTLVLAVTPYRLFSNRLRWSSYSTQFLERKALYWGINPWHYGIIPVLAAHLFAVIFPETTSRLVgDPT 82  Geo...
WP_012468295               3 NSFIFVVLPYAALVMILFVTPYRFYTNRLTWSAYSTQFLEQKTLYWGAVSWHYGIILILLAHLAGIVCPHGMERLLgNQQ 82  Geo...
Q39YU9                     7 NTFIFVALPYVALAMLIVVTPYRYYSNRLTWSAYSTQFLERKTLYWGANPWHYGIIPIILAHTLGVVAPGAMKSLLgNVE 86  Geo...
WP_013008779               3 DILVYIIIPYLSIAFFIVGLVFNLSYGKLRNSAPATGFFEKNKLNTGSPLWHYGIIIVLIGHLSGLLLPGLFKLLFtNYS 82  Def...
bcmhgsc:HMPREF0733_10321 101 HTYHIValVGGSAAAAATILGLFLLLWRRRRNAQVFSATTMNDKFMYFVLVAVILAGTAATLISAFdpsgglppvnghev 180 Rot...
WP_013507026              83 RLYLLE--VTGLALGITTVIGIALLMVRRFTRPRVKVVTTTMDWVLLLLLLLQVISGVVIAVTLRWgsv----------- 149 Des...
Q1QHX3                    83 ALYTIE--LIGFTFGLAALIGLCVLIVRRFTTERILAVTSPMDGVLLLALLVQVALGFWVSLAYRWgad----------- 149 Nit...
Q2IJW0                    83 RLYALE--ITGMALAMLAVFGIALLLVRRAALARL---TAPMDWVVLALLLLQAATGLWIAYALRWggl----------- 146 Ana...
Q39WW0                   114 RLAVLE--VTGLALGLFTLAGIVVLLFRRIASPKAWAVVTVMDLFLLAVLVLQVGTGLYNAFVYRWgsl----------- 180 Geo...
WP_012964841              83 MLIVLE--SIALALGLLALVGSVILLIRRASG-IVRAVTSYSDWIVLLLVLNQAITGVYMGVFARWgme----------- 148 Fer...
WP_012470699              83 QLLVVE--ATGLGLGIMALVGSLILLLRRANAPMLNKVTFRADWLALLLLLFQTASGIAVAITNSWgaq----------- 149 Geo...
WP_012468295              83 TLIVLE--SIGIGLGLLALFGSVMLLLRRVNATILKQVTFASDWVLLFLLVLQTATGVYVSTFMRWgsv----------- 149 Geo...
Q39YU9                    87 VLVFLE--SVGLGLGLFALFGCVVLLLRRVNAPMLKRVTYPADWVLLILLTFQTLTGVYISLFMRWgsq----------- 153 Geo...
WP_013008779              83 VLLLFE--ALAVSSGLIAFIGILVLLIRKFAVKSVNKHSLFTDYIFMILLFIQVVLGLIIAINYKWgia----------- 149 Def...
bcmhgsc:HMPREF0733_10321 181 efnyRTSIAVWFRSIFYFHPEVALMVNVPVAFKIHIIVAMVLFIIWPFTRLVHALTVPLHYLFRPYTIYRSR 252 Rothia dent...
WP_013507026             150 --wyLHTATPWLWSLFSLSPQVEYMANLPWIVKFHAVNAFVLIAVLPFTRLVHVLSVPLGYLWRPAQVVIWN 219 Desulfurisp...
Q1QHX3                   150 --wyIDTAVPWLISLVSLNPQTHYVSALPLAVKAHMLTGFVVIALFPFSRLVHLIMFPFWYLWRPYQLQIrn 219 Nitrobacter...
Q2IJW0                   147 --wyLHTAAPWLASLATLSPRVDAMAVLPPLVKVHVVNAFVLLALVPVSRLVHATSLPLAYLWRAPQRVVWR 216 Anaeromyxob...
Q39WW0                   181 --wyLSLAVPWLHSLACLNPDIKYIVPLPLPVKVHLFNAFVIFVLFPVTRLVHIVSIPVSYLWRPWQIAVWN 250 Geobacter m...
WP_012964841             149 --wyLYTAVPWLYSLLTLNPQIGYVSELPLVFKLHVAGAFLILAVLPFTKFVHFLFLPLDFLKDPPLLYRWA 218 Ferroglobus...
WP_012470699             150 --wyPATATPYLRSLLMLNPQPEYLIGISTIFTLHVAGAFLLLAVLPFTKLVHLLFLPLDFLKDPPIPYRWH 219 Geobacter l...
WP_012468295             150 --wyLHTAVPYIYSLLSFRPQMEYVADFPLVFKLHVGMAFLIIALLPFTKLVHLLFFPYRFLADPPILYRWR 219 Geobacter l...
Q39YU9                   154 --wyLHTAVPYLYSLLYFNPKVEYLADFPLILKLHAAGAFLIVALLPFTKLVHLLYWPLDFLKDPPILYRWR 223 Geobacter m...
WP_013008779             150 --wyVSNITKYLWSILILSPQVKYVEGFPILVTFHFLIAFILFAILPFTRLIHVVFVPIGYFFRKPQRiiyn 219 Deferribact...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap