1MGP,3EGL,6DKE,3FYS,6CNG,2G7Z


Conserved Protein Domain Family
DegV

?
pfam02645: DegV 
Click on image for an interactive view with Cn3D
Uncharacterized protein, DegV family COG1307
The structure of this protein revealed a bound fatty-acid molecule in a pocket between the two protein domains. The structure indicates that this family has the molecular function of fatty-acid binding and may play a role in the cellular functions of fatty acid transport or metabolism.
Statistics
?
PSSM-Id: 396973
Aligned: 41 rows
Threshold Bit Score: 189.344
Threshold Setting Gi: 81552050
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MGP_A  27 KVKILVDSTADV-PFSWXEKYDIDSIPLYVVWEDgRSEPDER--EPeEIXNFYKRIREAGSVPKTSQPSVEDFKKRYLK- 102 Thermotoga maritima
Q9RDL7   4 HVAIVTDSTAYL-PARAMERHGITAVPLTVVLGD-RALEEGT--EI-STRSLAQALQKRRPV-TTSRPNPELFAETYRR- 76  Streptomyces coelicol...
3EGL_C   5 PVRVIVDSSACL-PTHVAEDLDITVINLHVXNNG-------------EERS-------------TSGLSSLELAASYARq 57  Corynebacterium gluta...
P9WP05   2 tVVVVTDTSCRL-PADLREQWSIRQVPLHILLDG-LDLRDGV--DE-IPDDIHKRH------ATTAGATPVELSAAYQRa 70  Mycobacterium tubercu...
Q9RY87  13 SLKVIVDATADL-SEADLARSGVWQLASVVRVGG-QSYSST---EL-SPERLLALIEAQGAAPVIEPPSVDAYEQVFRQ- 85  Deinococcus radiodurans
P75312   2 KTAIITDSTASI---KEGEIQDVYVLPLQVIINGqDTYRDGKdiDY-DRVYQLLKEHPQGLNISTSLPRQADLIELIEA- 76  Mycoplasma pneumoniae...
Q98PF7   3 KLGIIIDSFTSItEDEFKKLEDFYFLPLQLILDG-TSYEDNP--SN-DRQKLFDKIIQASDI-KTSLPISSTIEKAVNE- 76  Mycoplasma pulmonis U...
Q98QK2   2 KIAIVIDSSSGL-TKEQANKRGWYFLPLNIDIDE-KTYKDGI--DL-DNKNFFEIFKKNSKTS-TSASSRGEIISLFDD- 74  Mycoplasma pulmonis U...
Q9PPV5   4 SFLIMTDSSTTL-DREWAKNNDVMILPLSILRSDhTLIVDDGieS--KPERIYEDIDNGYTFQ-TSCTPYGVLIEAIEQ- 78  Ureaplasma parvum ser...
Q8XHH5   3 KIAIITDSSCDL-TIDEIKDYNLNILPLKIIYKD-REYNDIF--DI-KPIDVYENL--HNEVPTTSLCSPDYINSVLDK- 74  Clostridium perfringe...
1MGP_A 103 YKEEDYDVVLVLTLSSKLSGTYNSAVLASKEV---DIPVYVVDTLLASGAIPLPARVAREXLENGA-TIEEVLKKLDERX 178 Thermotoga maritima
Q9RDL7  77 IAESGADGIVSLHLSAELSGTHDAAVVAAREA---PVPVRVVDTGMIAMALGFCALAAAETAEAGG-TVDEAVTAAEKRA 152 Streptomyces coelicol...
3EGL_C  58 LERGGDDGVLALHISXELSSTWSAAVTAAAVFd--DDSVRVVDTSSLGXAVGAAAXAAARXAXDGA-SLQECYDIAVDTL 134 Corynebacterium gluta...
P9WP05  71 LADSGGDGVVAVHISSALSGTFRAAELTAAEL---GPAVRVIDSRSAAMGVGFAALAAGRAAAAGD-ELDTVARAAAAAV 146 Mycobacterium tubercu...
Q9RY87  86 -ALAQSDEVLSLHLSSRLSVSFACGQEAARAF---GSRVRVLDSPAGSYALGLQALRAARLAAGGH-NAAAIVSALRAVQ 160 Deinococcus radiodurans
P75312  77 -IKDKYDRFVFLPLSKGLSGTYDMIVQAVKPLstpKKEFVVLETSDIAISLKWLVQEVKALTDTNC-PTKAIAEVVDQHK 154 Mycoplasma pneumoniae...
Q98PF7  77 -SSQKYNDVLVLPIASFLSGTISVINVYAQKH----KNVHIFDNHFVANTIVEIGLQAKKMYEQENkSIKEIITWLEEIN 151 Mycoplasma pulmonis U...
Q98QK2  75 -ITSKYDKVVVFPISYKLSSQYQNLDLIAREY----KNIHIVKSKHLSFLTIVQLIKFEKAIGQNQ-SFDEELKKLSHWD 148 Mycoplasma pulmonis U...
Q9PPV5  79 -KLQEYEKIIFIGISSGFSSQFNNAKNLEKEY---QDKLFVVDTEDFGYSLEHLVYKIKAMLSNNI-SFGDILKMINKHH 153 Ureaplasma parvum ser...
Q8XHH5  75 LEAEGYTHLIGIFISSSLSGTFNAARLVIEERs--SFKYYLFDSKIIGYPLGSIVIKAAEFVKEGK-SFEEIIEALSIIR 151 Clostridium perfringe...
1MGP_A 179 KNKdfKAIFYVSNFDYLVKGGRVSKFQGFVGNLLKIRVCLHIEN-GELIPYRKVRGDKKAIEALIE----KL--REDTPE 251 Thermotoga maritima
Q9RDL7 153 AGT--SAYFYVDTLDYLRRGGRIGAAQALFGSALAVKPLLQLEG-GRIEPLEKVRTASKAIARLEE-----I--AADRAG 222 Streptomyces coelicol...
3EGL_C 135 XRS--ETWIYLHRIDEIWXSGRISTATAXVSTALATRPIXRFNG-GRXEIAAXTRTQSXAFAXLVE-----L--AQIRAD 204 Corynebacterium gluta...
P9WP05 147 SRI--HAFVAVARLDNLRRSGRISGAKAWLGTALALKPLLSVDD-GKLVLVQRVRTVSNATAVMID----RV---CQLVG 216 Mycobacterium tubercu...
Q9RY87 161 ARQ--LMHFTVSDVRFMHLSGRITPVTAPLERSHDVQPIFRYHH-GLVELTARAPDHEAAMRQLAR----SVtkFVTETL 233 Deinococcus radiodurans
P75312 155 QSI--FTAVTVKNLVQLRKGGRISGLKKIIATLLRVKPIIFFDK-GVNTLSGKAFTFVQALEKIFT----FVksK-FGDN 226 Mycoplasma pneumoniae...
Q98PF7 152 TKT--ITFLSLKTLDYLVKGGRISGVKKFILTKLKLFPIIQSY--TNNSIAGLKRTFKSSLEKIYNklaeFI---GGENN 224 Mycoplasma pulmonis U...
Q98QK2 149 ESQ--KVLLIPEYNDALVAGGRLSPKAAALAKVLKVVPIIKFEN-GELLKEGKGISFQKTLTKLIS----SLsgKYSKDS 221 Mycoplasma pulmonis U...
Q9PPV5 154 DYT--SSFLACENITGLVRSGRIPKIIGTMLKLSKVTPIIKAE--WKNHRAGMALNIRSAPHKILEninhVF--DNQLNN 227 Ureaplasma parvum ser...
Q8XHH5 152 EAT--TGFYTLNTLEYLRRGGRIGKVAGTVGDLLHLKPIISVDEhGAYTTIAKARGRKQSLKKLAS-----I--ILEHLD 222 Clostridium perfringe...
1MGP_A 252 GSKLRVIGVHAD--NE-AGVVELLNTLRK--SYEVV-DEIISPXGKVITTHVGPGTVGFGIEVL 309 Thermotoga maritima
Q9RDL7 223 GAPVDIAVHHLA--AP-DRASALADRLRD--RVPGLaDLHVSEVGAVIGAHTGPGLLGVVVSSR 281 Streptomyces coelicolor A3(2)
3EGL_C 205 GEPVFIAIGQNE--AR-EAAXQLEELLRN--ALPEGsSFXSVDIDPTLAVHSGPGAVSVSAVFA 263 Corynebacterium glutamicum ATCC 13032
P9WP05 217 DRPAALAVHHVA--DP-AAANDVAAALAE--RLPACePAMVTAMGPVLALHVGAGAVGVCVdvg 275 Mycobacterium tuberculosis H37Rv
Q9RY87 234 PEGARVAFLHSP--GGeEGAERLRTLLSA--SGLTYeDAGTRSIGNHLLAVTGPRATGVVAEPL 293 Deinococcus radiodurans
P75312 227 FKIKRIGFCNAFtpVKaKEVKALILDFLHtnKITLQrEIESSFITSAIIAHTGIDAFSISLLLD 290 Mycoplasma pneumoniae M129
Q98PF7 225 FKNYNLKLVHGP--SK-EMVDGAVEFFKQ--KGLE--FSSIVLASTVIIAHTGPDSISISVVPK 281 Mycoplasma pulmonis UAB CTIP
Q98QK2 222 KNYFPVILHAQN-----SNISFYEEHFLN--EFGK--KPLILSLPSVISVHTGLGAIAISLVKV 276 Mycoplasma pulmonis UAB CTIP
Q9PPV5 228 HTIEKVCILQAG--LSsERIDELKNDVINhfHVDKE-KIVIRSGPPIFLVYVWKGALGIQVIAN 288 Ureaplasma parvum serovar 3 str. ATCC...
Q8XHH5 223 EGKCNVAILNGM--AE-EEANQVLDSISS--HPNLL-KSQVRAIGAAMGVHAGPGMVGVSIQKE 280 Clostridium perfringens str. 13
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap