Conserved Protein Domain Family
DUF188

?
pfam02639: DUF188 
Uncharacterized BCR, YaiI/YqxD family COG1671
Statistics
?
PSSM-Id: 396970
Aligned: 106 rows
Threshold Bit Score: 108.715
Threshold Setting Gi: 17433201
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4FV14        17 LIIKTAERTQTMAIFVANQPIKLRKsPLLVMTVVPSGFDKADDYIVEQIQPGDLAITSDIPLANDILDKGGMVLTTRGVV 96  Psychrobacter a...
Q97FB5        15 IVERVAQEMKIPVTLLCDTNHILNS-TYSDIKIIGAGADAVDFALINLCHRGDVVVTQDYGVAAMALGKGAYAIHQSGKL 93  Clostridium ace...
WP_021944548  15 iVETIAEKYNIPTTLLCDTNHVLYS-DYSEVIVVGAGADAVDYKLISICHKGDIVVSQDYGVAAMALGKGAYAIHQSGKW 93  unclassified Cl...
CUO65215      15 IVEQIAKEYEIPVTLLCDTNHVLYS-DYSEVVTVGAGADAVDFKLVSLCHKGDIVVTQDYGVAAMILGKGAYGIHQNGKW 93  Dorea longicatena
B8I8V6        15 IITKNAKKYGIPVIMIIDTSHELND-GYSTVITVDKARDSVDIKLINMVQRGDIVVTQDYGVAAMGLGKGAKVLNQNGLI 93  Ruminiclostridi...
CAL84836      15 IIEQVAKKYKIDVMMFCDINHVINS-NYSIIKYVDHGFQSVDMALINETRENDIIITQDFGVAAMALGKKAKSINPKGYI 93  Clostridium bot...
A0Q2Q9        15 LIEKAAIENSVEVIMYCDINHELKS-DYSEVRVVDSGFQSVDMKIINEAKENDIIVTQDYGVAAMVLGRKAFAISPKGYI 93  Clostridium nov...
A5N2Y5        15 IIENIARENDIEVIIYCDTNHILKS-NYSTVVTVDSGFQSVDMVIVNKVRSGDIVVSQDYGVAAMVLGKKAYAINPKGYI 93  Clostridium klu...
Q891H3        15 MIEKAASENNVEVIMYCDINHRLES-SYSEIKYVESGFQSVDMVIVNEVKKGDIVISQDYGLAALVLGKGAYAINPKGYI 93  Clostridium tet...
Q8XI55        15 IIEEVGKKHSVKILIYCTINHMINS-DYSEVRMVDGGFQSVDMYVANNTEENDIVITQDYGVAAMALGKGALAISPRGYI 93  Clostridium per...
Q4FV14        97 YDKNNIKQKLNMRDFMDTMRGTGVlelqeMSGQKPYGDRDKKAFADGLNKLV-R 149 Psychrobacter arcticus 273-4
Q97FB5        94 YENDNIDRMLMERHIAKKARRASSkn--hMKGPRKRTSEDDERFEAAFRRLImR 145 Clostridium acetobutylicum ATCC 824
WP_021944548  94 YTNENIDQMLMERHLNKKARRSCHkh--hMKGPRKRTEDDDLRFAQSFEKLIrm 145 unclassified Clostridium
CUO65215      94 YTNENIDRMLMERHLAKKARNAKKkh--hLKGPSKRTDEDDRRFAESFTRLVek 145 Dorea longicatena
B8I8V6        94 YSDANIDRLLFERHLGQKIRRAGGr----TGTIRKRSKENDEAFEKALLLFI-K 142 Ruminiclostridium cellulolyticum H10
CAL84836      94 FSNNNIDRMLFERHISAKMRRAGIk---nTSTHKKRGSEDDTRLEKNLIKLIie 144 Clostridium botulinum A str. ATCC 3502
A0Q2Q9        94 YDDDNIDRLLFERHLSAKARRGGKk----TFNPKKRTDEDNLRLYNNILKLInK 143 Clostridium novyi NT
A5N2Y5        94 YHEGNMDKLLFERYISSKVRRTGGr----TSNPKKRTKEDDKRLRENLFQLIlN 143 Clostridium kluyveri DSM 555
Q891H3        94 YDNDNIDRLLFERHMSGKIRRSGGk----TFNPRKRMEEDDKRLYENLIFLIgK 143 Clostridium tetani E88
Q8XI55        94 YDNDNIDRLLFERHLSQKNRRAGGk----SKGNHKRNKEDDDRLYYNLEVLIek 143 Clostridium perfringens str. 13
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap