5I8I,3OEP,5DUD


Conserved Protein Domain Family
CT_A_B

?
pfam02626: CT_A_B 
Click on image for an interactive view with Cn3D
Carboxyltransferase domain, subdomain A and B
Urea carboxylase (UC) catalyzes a two-step, ATP- and biotin-dependent carboxylation reaction of urea. It is composed of biotin carboxylase (BC), carboxyltransferase (CT), and biotin carboxyl carrier protein (BCCP) domains. The CT domain of UC consists of four subdomains, named A, B, C and D. This domain covers the A and B subdomains of the CT domain. This domain covers the whole length of KipA (kinase A) from Bacillus subtilis. It can also be found in S. cerevisiae urea amidolyase Dur1,2, which is a multifunctional biotin-dependent enzyme with domains for urea carboxylase and allophanate (urea carboxylate) hydrolase activity.
Statistics
?
PSSM-Id: 396958
Aligned: 586 rows
Threshold Bit Score: 159.119
Threshold Setting Gi: 222119840
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5I8I_C        1094 IGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAVSGGTVSCTLNDaqiaQNEPIEVKRGDILSVG 1173 Kluyveromyce...
jgi:Tola_1859   29 QGVSRAGALDSLSLRIANRLVGNPEEAAGLELLFGNTRIRFLKEIWFALAGCECFATLNGkpvlLGWTKRARAGDELVIG 108  Tolumonas au...
WP_011758145    24 LGLPRSGALDRQALLLANRLLGNPDNTPVLEFALGQSSLRFHRDAWIALTGADFDARIDAkpvwCGWRSLIKAGQTLSLR 103  Shewanella a...
BAJ00009        24 LGVSVSGALDRQALMLANRLVGNPDNAAGLELTAGTFELKFHRDAWFTLTGAKYEIKIGAreiwHGWRNKIQAGETLSLR 103  Shewanella v...
WP_013201313    24 YGVGLSGVLDRPAMETANLLVGNDKNSAVLEITLGQFSAEFTRDGWIALTGAGCSAELDSqpvwTGWRTAVKKGQRLTLS 103  Erwinia
WP_013025051    24 YGIGVSGVLDQPAMITANLLVGNPPGSAVLEIVLGQFKAEFRRDGWFALTGAGCQAELDGkpvwTGWRLPVKKGQVLVLK 103  Pantoea anan...
CAL21318        24 LGISQGGALDLPALSMANMLVGNASDAAGLEITLGQFTAEFTQSGWIALTGAGCDARLDEqrlwTGWCYPVKAGQQLKLS 103  Yersinia pes...
WP_025422945    24 LGINQGGVLDAPAMKMANLLVGNAQDAAVLEITLGQFCAEITRPGWLALTGADCHARLDDkplwTGWRFAVRPGQQVKLA 103  Sodalis prae...
Q6D7H3          24 LGISQSGALDLPALKMANLLVGNAESAAALEITLGKFTATFTTACWVALTGADCHAELDGkplwTGWRFAVKPGQTLKMG 103  Pectobacteri...
WP_013317011    24 LGISQCGALDSPALKLANLLVGNDMGTAALEITLGQLAATFTAPCWIALTGADCHATLDGktlwTGWCFAVKPGQTLRLR 103  Dickeya dada...
5I8I_C        1174 KVTvGCRAYLSIRGGIDVPEYLGSRSTFAMGNMGGyngrILKLGDVLFLNQPELSVSSlpapdfepqaapKSLLPTLSTN 1253 Kluyveromyce...
jgi:Tola_1859  109 MPRnGLCAYLAFEGGIDVPVLMGSKSTDVQGAFGGwegrKLIAGDLLPIGKKHPKQLK-------------NRGVLLPVL 175  Tolumonas au...
WP_011758145   104 GPKaGMRAYLAVDGGVQVPPFMGSASTDLSSGVGGlegrSLKSGDRLELGTEKPLKH--------------PVGAMQPSW 169  Shewanella a...
BAJ00009       104 GPKsGMRAYLAIDGGVDVSICLGSRSTLVTAALGGhlgrALKIGDRIPLGEKLSLSK--------------PIGAVQRGY 169  Shewanella v...
WP_013201313   104 MPHrGMRSYLALDGGFAVEPMLGSCSTDAKAGFGGfnggPIKDGDLLPQREPQRHFLK------------PVGVRQLLFG 171  Erwinia
WP_013025051   104 KPVhGMRSYLAIQGGFDVPEVLGSCSTDIKAGFGGfqgrTLQDGDRIPLGKPGQPFTH------------KKGVKQLLWG 171  Pantoea anan...
CAL21318       104 VPHrGMRSYLALSGGIIVPEILGSRSTDLKAGFGGhqgrLIKEGDRLPLGKPTRLPSE------------SVGVKQLLFG 171  Yersinia pes...
WP_025422945   104 LPKhGMRSYLAVSGGFDVPPVLQSRSTDIKAAIGGlegrWVRDGDRLPVGEPGRLPTR------------QMGIKQLLFG 171  Sodalis prae...
Q6D7H3         104 LPRnGMRSYLALSGGVDVPEALGSRSTDLKAGFGGfdgrLLLDGDELPLGTPTRELTR------------EVGIKQLLFS 171  Pectobacteri...
WP_013317011   104 SPRnGMRSYLAVSGGIAVPEVLGSRSTDLKARIGGlegrPLADGDTLPLGKPRRLPGR------------SIGVKQLLFS 171  Dickeya dada...
5I8I_C        1254 KDwkiGVTCGPHGsiDLFKEEYIEQFFNDKWKVHYnSNRFGVRLigpkpkwarsDGgeAglh-------psNAHDYVYSL 1326 Kluyveromyce...
jgi:Tola_1859  176 NQv-iRVLAGPEM--EQFSSATQDAFFNHGWKVTAdSNRMGFRL----------EGe-Tlrrt-----estDLLSHGVFP 236  Tolumonas au...
WP_011758145   170 DNl-lRVLTGPQY--PLLSDTS--TLTKAMWRVQPsSNRMGARL----------EGp-Alhls-----kplEMASQGVFP 228  Shewanella a...
BAJ00009       170 SSe-iRALPGPEM--ALFTQESRKVFWSSQWQVSNeSNRMGARL----------SGq-Alsle-----qeqSLNSHAVMP 230  Shewanella v...
WP_013201313   172 NRi--RVMMGPEY--HEFTHESREAFWRTAWKLNPqSNRMGYRL----------QGr-Plqrs-----ekrEMLSHGLIP 231  Erwinia
WP_013025051   172 NRi--RALPGPEY--HEFSEEAQQKLWRAAWTLNPqSNRMGYRL----------QGp-Tlqre-----asrELLSHGLVP 231  Pantoea anan...
CAL21318       172 NRv--RAVPGPEY--HEFDEVARNAFWREAWQLSPqSNRMGYRL----------SGr-Eltrn-----ttrEMLSHGLLP 231  Yersinia pes...
WP_025422945   172 NRv--RALPGPEY--QEFSAEAREAFWRVAWQLSPqSNRMGYRL----------QGs-Alvrt-----adrELFSHGVLP 231  Sodalis prae...
Q6D7H3         172 NRv--RALPGPEY--QEFSEEMQELFWRTSWQLSPqSNRMGYRL----------LGa-ElqrtassgnkprELPSHGLLP 236  Pectobacteri...
WP_013317011   172 NRv--RVLPGPEY--QEFSEAAHDNFWRTGWHLSPqSNRMGYRL----------LGp-Elvre-----nqrEMLSHGLLP 231  Dickeya dada...
5I8I_C        1327 GAINF-TGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVP 1376 Kluyveromyces lactis NRRL Y-1140
jgi:Tola_1859  237 GVIQVpPNGQPIILAAEAQATGGYPRIATVIQPDLWKLGQLRPGAFVHFKR 287  Tolumonas auensis DSM 9187
WP_011758145   229 GVIQLpPSGQPIVLLNDAQTTGGYPIIATVIEADLWKLAQARPGQPLQFVL 279  Shewanella amazonensis
BAJ00009       231 GTIQVpPSGQPIVLLADGQTTGGYPKIATVIEADLWKLAQTRPGDKLQFTH 281  Shewanella violacea DSS12
WP_013201313   232 GVIQVpPNGQPIVLMADAQTTGGYPRIGCVIEADLYHLAQIRLGEPMHFVY 282  Erwinia
WP_013025051   232 GVIQVpGNGQPIVLLADAQTTGGYPRIACVIESDLYHLAQIRLGEPIHFIL 282  Pantoea ananatis
CAL21318       232 GVVQVpHNGQPIVLMADAQTTGGYPRIACVIEADLYHLAQIRLGEPIHFVP 282  Yersinia pestis CO92
WP_025422945   232 GVVQVpPGGQPIVLMADAQTTGGYPRIACVIEADLYHLAQIRLGEPIHFVQ 282  Sodalis praecaptivus
Q6D7H3         237 GVVQVpHNGHPIVLLADAQTTGGYPRIASVIEADLFHLAQIRLGEPIHFIH 287  Pectobacterium atrosepticum
WP_013317011   232 GVIQVpHNGKPIVLMADAQTTGGYPRIGCVIEADLYNMAQLRLGEPVHFIR 282  Dickeya dadantii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap