Conserved Protein Domain Family
UxaC

?
pfam02614: UxaC 
Glucuronate isomerase
This is a family of Glucuronate isomerases also known as D-glucuronate isomerase, uronic isomerase, uronate isomerase, or uronic acid isomerase, EC:5.3.1.12. This enzyme catalyzes the reactions: D-glucuronate <=> D-fructuronate and D-galacturonate <=> D-tagaturonate. It is not however clear where the experimental evidence for this functional assignment came from and thus this family has no literature reference.
Statistics
?
PSSM-Id: 396948
Aligned: 18 rows
Threshold Bit Score: 687.087
Threshold Setting Gi: 500835375
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7N9X5          1 MKNFMCDDFLLNNETARQLYHEHAADMPIYDYHCHLNPREIAENRRFDNLGQIWLE----GDHYKWRAMRCAGIDESLIT 76  Photorhabdus l...
WP_022037931    1 MKPFMDEEFLLSTPTAQKLYHDFAETMPILDYHCHINPEEIAKDVCFENITQVWLG----GDHYKWRQMRSNGVDEYYIT 76  [Ruminococcus]...
Q8E0M9          1 MA-FNTETFMLKNQAAIQLYEE-VKRQPIFDYHCHLDPKDIFEDHIFDNIVDLWLG----GDHYKWRLMRANGISEAEIT 74  Streptococcus ...
jgi:Ccel_1676   3 VKTFINNNFMLKSKTAASLYHFNAASVPIFDYHCHLSPKEILENRTFSNMTEIWLA----GDHYKWRLMRANGVDERCIT 78  Ruminiclostrid...
WP_012003323    1 MA-FLDERYLLSSKTAFDLYES-VKNLPIVDAHNHGDVKEIVENKGWNDIWEVEAA----TDHYVWELMRRRGVPEDKIT 74  Pseudothermoto...
Q03U02          1 MD-LLDNDFLLGNDMAKKLFHDYAQNMPIIDFHCHLNPEEIYENKNYENITKIWLNegtyGDHYKWRLMRANGVPEKLIT 79  Lactobacillus ...
Q1GMX1          1 MTGFLHQDFLLDTATARRLFHEVARYLPIVDYHNHLPPAEIASDRTWENLGEMWLA----HDHYKWRVMRWAGIDEARVT 76  Ruegeria sp. T...
Q7MBZ3          1 MKNFLCEDFLLSNETARRLYHEHAFHQPIYDYHCHLNPAEVAQNRQFDNLGQIWLE----GDHYKWRGMRSAGIEERLIT 76  Vibrio vulnifi...
EAR01172        1 MKTFISEDFLLQNDFGKVLFHDHAKNLPIIDYHNHLSPKEICKNRVFENISQVWLA----GDHYKWRAMRALGVNERFIT 76  Maribacter sp....
Q01VN6          1 MS-FIHDDFLLSSKTARRFYHTFAEDQPILDYHCHLPPQDVAANRQFKDLFEIWLE----GDHYKWRAMRANGVPESHCT 75  Candidatus Sol...
Q7N9X5         77 GkQTRDYEKYQAWAETVPLTLGNPLYHWTHLELRRPFGISGiLFGPQTADEIWHQCNEKLAAPAFSARGIMQQMNVRMVG 156 Photorhabdus l...
WP_022037931   77 G-DAPAREKFQKWAETLEKAVGNPLFHWSHLELKRYFGYNG-VLNGETAEEVWNLCNQKLQEPSMSVRNLIRRSGVTLIC 154 [Ruminococcus]...
Q8E0M9         75 G-PASNLEKFKAFARTLERAYGNPVYHWSAMELKNVFGVNE-ILTESNAEEIYHRLNHFLKEHKISPRRLIADSKVMFIG 152 Streptococcus ...
jgi:Ccel_1676  79 G-DADPYEKFLKWAETVPKCIGNPLYHWTHLELKHYFDIDE-LLVPESAPEIWKACNNKLKSPEFTTRGIIERFNVKALC 156 Ruminiclostrid...
WP_012003323   75 G-DATNYEKWIALAEVFPKFAGNPTYEWVHLDLKRRFGINE-TISRQTAETIWYRSKQILNEDKMKPQNILREMNVEIMC 152 Pseudothermoto...
Q03U02         80 G-DGDDYDKFMAWAETIEKSMGNPLYEWTHLELKRFFHIDE-VFSRKTAPEIWKKANALLQTEDFKPRNLIKNSNVKAVC 157 Lactobacillus ...
Q1GMX1         77 G-DATWREKFDAFAEAMPRAVLNPVHHWSHLELWRYFDLNGtVLSPISADNVWDAANAQLGEKGYSAQSLLRKMKVELVG 155 Ruegeria sp. T...
Q7MBZ3         77 G-DASDYDKYMAWAKTVPQTLGNPLYHWTHLELRRPFGITNaLFSPDTADQIWHQCNELLATPEFTARGIMQQMNVVMAG 155 Vibrio vulnifi...
EAR01172       77 G-AASDKEKFSKWSSTVPFTMRNPLYHWAHLELQRYFGISE-LLSEQNANAIYQETSEKLQNRTHHTVGLLQQQNVETLC 154 Maribacter sp....
Q01VN6         76 G-NAPAYEKFMAWAKTVPATLRNPLYHWTHLELKRYFGIDE-LLNEQSAARVWEQANAVLATPELTAHRILEKFHVKAVC 153 Candidatus Sol...
Q7N9X5        157 TTDDPVDSLQYHRQIATDESFD-IEVLPSWRPDRVFKIEL-AGFIDYIKQLEAVADVSIVAFADVLNALERRLEHFAAHG 234 Photorhabdus l...
WP_022037931  155 TTDDPADSLYWHKELAADDSFE-VQVLPAWRPDKAMNIEK-PDYAEYLKKLGQAAECQIETFADLKMALKKRMDAFEEMG 232 [Ruminococcus]...
Q8E0M9        153 TTDHPLDTLEWHKKLAADESFK-TVVAPTFRPDEAF-IEH-RHFVDFITKLGDITQKEITDFSTFIAAMEERIAYFAQNG 229 Streptococcus ...
jgi:Ccel_1676 157 TTDDPIDDLKSHIELEKDKNFK-VKVLPTFRPDKALQIEN-TGFADWIASLSKVTEMNISSFEDLILALQKRAEFFKSIG 234 Ruminiclostrid...
WP_012003323  153 TTDDPTSDLVYHKLA--REKIPsIRILPTWRPDRTCKIDT-KDWKNYVEKLSMSTNTDISNLDDFLNALEKTHGYFNDLG 229 Pseudothermoto...
Q03U02        158 TTDDPASDLHYHKEIKKDEAENgFRTLPAMRPDKLIQIDR-DGFAAYLKELGDISGVQISSFKDIIKALHQRFTFFNEMG 236 Lactobacillus ...
Q1GMX1        156 TTDDPLDTLEHHAAMAGSD----IRVVPTFRPDKSVQIEA-PGFAAYMDSLEALTH-PIHSFDDLVAALSLRLDYFVEQG 229 Ruegeria sp. T...
Q7MBZ3        156 TTDDPIDSLEHHKAIAEDDTFN-VKVLPSWRPDKAFKIEL-DVFADYMHKLGEVADIEIRRFDDLLSALDKRLAHFDAHG 233 Vibrio vulnifi...
EAR01172      155 TTDDPIDSLEYHERIKSNNGS--LNVYPAFRPDKAYGVESpKVYLNYIDALSETVNFTIKNYDDLLTALENRIDFFHSKG 232 Maribacter sp....
Q01VN6        154 TTDDPTDDLAAHQAIA-ASGLA-TKVFPTFRPDKALHVHApELFNPWVDRLQVAADTHISTMAEFLDAIKKRHDFFHAMG 231 Candidatus Sol...
Q7N9X5        235 CRAADHGIENLRYAPiPDETVLNGILQKRLAGGILSELEIAQYTTAILVWLGRQYAARGWVMQMHIGAIRNNNSRMFRLL 314 Photorhabdus l...
WP_022037931  233 CRASDHALEYVMYVP-ETEENLEKIFAKRKQGEMLTKEEELKFKTAFMAFAAGEYTKRNWAMQLHYGCKRDNNAARYAQL 311 [Ruminococcus]...
Q8E0M9        230 CRASDISFTEIVFEQ-TDELELNDLFNKVCEGYIPNQSEISKWQTAVFMELCRLYKKYGFVTQVHFGALRNNHSTIFEKL 308 Streptococcus ...
jgi:Ccel_1676 235 CMISDHSFGYPDFTK-GKLHEARSAFLKAMAGEELEQGEIEAYKTQLMLALGRTYHRLGFAMQLHFGVVRNTNTKMLKST 313 Ruminiclostrid...
WP_012003323  230 CVCSDHAL-LNPFLEpVDKHKASQIFDNS-MKQSASHEDLMIFQSYMMYKFAEMNTKENWTMQLHIGSYRDYRKKLFDSL 307 Pseudothermoto...
Q03U02        237 GRLSDHSLLTYHFVE-ATDSELDAIVNKGVNNEDLTPKELDQYITMLLENLMKLNKEFDWTMQFHVNSIRDLNRPMFDKL 315 Lactobacillus ...
Q1GMX1        230 CRAADHGISHLDAANiPGAFDLDAALKAARQGKPITPEQVAGHRAALFDALGRAYAVRGLVMQCHMNVVRNGSSRLLLGV 309 Ruegeria sp. T...
Q7MBZ3        234 CRAADHGIEIVRYAPiPSEADLDALLARRLSGEVLSELECAQFSTAVQVWLGKRYAQLGWVMQLHIGAQRNNSTRMFQLL 313 Vibrio vulnifi...
EAR01172      233 SRIADHGLEQLYHFS-TKKLDCNILFKKLKDNKQLTKEEISYFKAETLLFLSKCYHKKGWVQQYHLGAIRDNNKRLLSQL 311 Maribacter sp....
Q01VN6        232 GRLSDHGIN-HAFSDfPSEHEAARIFGRARCGHAATSEEHGKFAAYMMLVFGRLDAEKGWTKQLHLGARRNNSTRRFREL 310 Candidatus Sol...
Q7N9X5        315 GADSGFDSIGDNN-IAWPLSRLLDSMDVTDELPKTILYCLNPRDNEVIATMASNFQ--GGGIAGKVQFGSGWWFNDQKDG 391 Photorhabdus l...
WP_022037931  312 GPDTGYDCINNYA-PSAQMADFLNALNEKNSLPKTIIYSLNPNDDEAIGTILGCFQ--DAGVAGKIQQGSAWWFNDHKTG 388 [Ruminococcus]...
Q8E0M9        309 GADVGVDSLGDQVaLTVNMNRLLDSLVKKDSLPKMIWYNLNPAYNIAVANTLANFQanELGVRSYLQFGAGWWFADTKLG 388 Streptococcus ...
jgi:Ccel_1676 314 GVDAGFDSIGNGI-SADSLISLLDWMNKTDELPRTVIYCLNDTDNAKIASIIGCFQ--STMFPSKLQLGAAWWFNDHRDG 390 Ruminiclostrid...
WP_012003323  308 GPDSGGDISAGFVdIARGMKEFFNAFDGKV---KIIIYCMDMTYLSVAATIARAFE--------NIFLGAPWWFNDSPFG 376 Pseudothermoto...
Q03U02        316 GADTGYDAVGTQPdIAGELQKLYTKMRSSNDIPKSIFYSLNDNDWMQLATMMGAFQ--EGGQQ-RLQLGAGWWFNDTAEG 392 Lactobacillus ...
Q1GMX1        310 GPDAGGDSMRDTD-MAGPLNILLDRLDRDGKLPRMVLYGLDPSRNPILAATAGTFQ--DGSVPGKIQAGAAWWFNDTLDG 386 Ruegeria sp. T...
Q7MBZ3        314 GADAGFDSIGDRP-FAFELAHLLDEMDQTNELPRTILYCLNPRDNEMMATMIGNFQ--GGGIAGKVQFGSGWWFNDQKDG 390 Vibrio vulnifi...
EAR01172      312 GADTGFDSIGDFS-QMRALSSFLNELDSSDQLSKTIIYNLNPSDNEAFATMAGNFN--DGSIKGKVQYGAAWWFLDQKDG 388 Maribacter sp....
Q01VN6        311 GADTGWDSIGDWP-QADALGTYLDRLDLENALPKTVIYNLNPADNYVIATMIGNFQ--DGVTAGKVQFGSGWWFLDQKEA 387 Candidatus Sol...
Q7N9X5        392 MLRQLEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCNVLGQWAEKGEIPNHKAMLGQIVEDICFNNARRYF 467 Photorhabdus laum...
WP_022037931  389 MIKQMTSLANLGLLGNFLGMLTDSRSFLSY-SRHEYFRRILCELIGGWIENGEYPDDERMLGKIIKDISYNNAVRYF 464 [Ruminococcus] gn...
Q8E0M9        389 MISQMNALAEQGMLANFIGMLTDSRSFLSY-QRHDYFRRILCTYLGEWIEEGEVPEDYQALGSMAKDIAYQNAVNYF 464 Streptococcus aga...
jgi:Ccel_1676 391 MVNHMQTVANHGLLSGFIGMLTDSRSFLSY-TRHDYFRRILCDLIGEWVEHEQVPLELDMLGSMVKDICFNNSVRYF 466 Ruminiclostridium...
WP_012003323  377 MRFQLQYIASVDLLSNFAGMVTDSRKLMSYgSRTEMFRRILCDVVGEMVDRGQIPFKEAL--ELCNELCYFRPKELF 451 Pseudothermotoga ...
Q03U02        393 MDNQLRIFAQESLLPNFVGMLTDSRSFLSY-PRHEYFRRVLCNFYGKLAEQGRVPNDEAALGQIVQDISYNNAYKFF 468 Lactobacillus bre...
Q1GMX1        387 MEAQMRTLAQVGLLSTFLGMLTDSRSFLSF-PRHEYFRRLLCGMIGRWAETGHLPDDADLLDRLVRDICYNNAKAWF 462 Ruegeria sp. TM1040
Q7MBZ3        391 MQRQMEQLSQLGLLSQFVGMLTDSRSFLSY-TRHEYFRRILCDMVGRWAENGEVPNDLSLLGPMVEDICFGNAKRYF 466 Vibrio vulnificus...
EAR01172      389 MEKQLNTLSNIGLLSCFVGMLTDSRSFLSF-PRHEYFRRVLCNLIGQDVERGELPADEKWLGKIVQDICYYNAKDYF 464 Maribacter sp. HT...
Q01VN6        388 MQWQMNALSNCGMFSKFLGMLTDSRSFMSY-PRHEYFRRVLCDLFGRDVENGELPDNDELIGPVIRDICYGNAQRFL 463 Candidatus Soliba...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap