2POF


Conserved Protein Domain Family
CDH

?
pfam02611: CDH 
CDP-diacylglycerol pyrophosphatase
This is a family of CDP-diacylglycerol pyrophosphatases, EC:3.6.1.26. This enzyme catalyzes the reaction CDP-diacylglycerol + H2O <=> CMP + phosphatidate.
Statistics
?
PSSM-Id: 396946
Aligned: 40 rows
Threshold Bit Score: 251.786
Threshold Setting Gi: 170657295
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2POF_A              7 SDTLRKIVLEECLpnqQQNQNPSPCAEVKPN----AGYVVLKDLNGPLQYLLXPTYRINGTESPLLTDPSTPNFFWLAWQ 82 
jgi:Mnod_7480      27 RDSLW-LVVRSCLgaeRLTGLPFPCVLVKAGdrtdPGYVLVRPPGARSHVLVVPTTPIIGIEAPALQSAQGFAYWRAALD 105 Methylobac...
jgi:Mrad2831_4384  29 RDVLW-AALKTCVlakRLANRTFPCLSVDLGdgtrPGSAVLRAPGEPTHSVVMPTDTVPGLEAPVLRGPRGAAYWRAALA 107 Methylobac...
WP_012321810       26 RDVLW-VALQGCVlakKAAGRSFPCLAVDLGdaarPGTAVLRAPGQPTHTVVMPTDSVSGIEASVLQGPRGAAYWRAALA 104 Methylobac...
jgi:Mnod_3452      37 RNLLW-VTLQTCIltkRMTGRALPCLAVDLGdkdrPGTAVLRAPGQATHVVVMPTERVVGLEDPQLQQRPGTAYWQAALA 115 Methylobac...
jgi:M446_3349      29 RDVLW-VALQGCIlakKTTGGAFPCLSVDLGdgarPGTAVLRAPGQRTHLVVMPTASVVGLEAPELQTSTGNAYWRAALT 107 Methylobac...
Q1LBK3             33 RDSLWKNVQERCLtpaTPTHS--DCVIVDRQ----RGFVLYKDMIGASHYLVIPVRPVSGVDDARVWSDREHNAWAFGWA 106 Cupriavidu...
Q0JZ98             25 RDGLWRNVQQRCLgstAAAHP--DCAQVDRS----QGLVLYKDAIGKSHYLVIPARTMTGIDDARAWDGAGANPWAFGWA 98  Cupriavidu...
bbmufp:Hsero_0296  34 PHKLWEITSQQCVphmQASGQPQPCAMVDLA----RGFVILKDLVGPAQYLLMPTRRLTGIESPELLEPQAPNYWAYAWQ 109 Herbaspiri...
jgi:Bphy_3475      29 PNALWKIVDHQCVpaaRASGRPGFCTSVDLQ----KRYAILKDINGNTQFLLIPTDRVTGIESPSVLDADAPDYWADAWA 104 Paraburkho...
2POF_A             83 ARDFXSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVREQLDNNLANISSRWLPLPGGLRGHEYLARRVTESE 162
jgi:Mnod_7480     106 SRRYIVDALKSRLPLSDVALAVNSKGGRSQDQLHIHLDCVDPSVRATLDARSGLIGSKWTRLPFGLEGDHYYALRVGAMN 185 Methylobac...
jgi:Mrad2831_4384 108 ARPLVSDALKGRLTPAEVGLAVNSARGRSQDQLHIHLDCLKPSVLKAVRAHGRQVRHTWSRFPVPLAGDRYYALRVPEAE 187 Methylobac...
WP_012321810      105 ARHYVSDALQGRLPASAVGLEVNSVGGRSQDQLHIHLDCMRRSVVAALKAHGDAVGESWAPFPVPLEEVSYVAMRVPADA 184 Methylobac...
jgi:Mnod_3452     116 ARHYVTEALGGRLTAYDVGLAVNSIGGRSQDQLHIHLDCVQPSVQAALQHYASTIGSTWAAMPIALQGSRFFALRVGADQ 195 Methylobac...
jgi:M446_3349     108 ARSTVTEVLKGELPIDDVGLAVNSTSGRSQDQLHIHVDCLKPSIQVALQRYAQGIRRAWTRLPMIVQGSPLYAMRVEAPD 187 Methylobac...
Q1LBK3            107 ARDIVGKAIGRALPDTLLGLAINARAARSQDQLHIHLDCISESARDFL--ASGAFDRQWRSL--TFRGKPVRVRLIPSDD 182 Cupriavidu...
Q0JZ98             99 ARGIVGRSLGKAVPDDMLGLAINSRASRSQDQLHIHLDCISSAARAVVNGAAGPIGTGWTTL--RLEDKPVRAIFVPASA 176 Cupriavidu...
bbmufp:Hsero_0296 110 QRARVAQTLGRALSDEQLGVEVNSAAGRSQLHLHLHIDCMRRDVAASLAAHRDDPLQQWRPW--HFEGHRYWVMRLPAEA 187 Herbaspiri...
jgi:Bphy_3475     105 ARQYVGSRIGLTFPPNQLGLEINSAYRRSQQQLHIHMDCMHDSVIKDLARFATVEPGQWHWT--TLDGNRYRVMRVLSLT 182 Paraburkho...
2POF_A            163 LVq-RSPFXXLAEEVPe-AREHXGSYGLA--XVRQSdNS--FVLLATQRNLLTLNRASAEEIQDHQCEIL 226
jgi:Mnod_7480     186 ARd-FNPFAALAH-LPa-TRGGLSATSLAvvATSPNdPHpgFYILAYQAPR-----AHAEALLDHQCEIA 247 Methylobacterium nod...
jgi:Mrad2831_4384 188 AAq-FNPFAALHT-LPg-ARPDLHRTSFAalATPPGdPEpgYILLAYRAPS-----ASAEDVMDHSCAVA 249 Methylobacterium rad...
WP_012321810      185 MAa-FNPFAALAR-VPg-WQGRLHDASFAavEADPGdPRggMILLAYREPE-----ASAEYLMDHSCRMA 246 Methylobacterium rad...
jgi:Mnod_3452     196 MRd-LNPFAALGH-LPg-RRTELRDTSLAmiSVSGEsGTrdFVLLAYRDPE-----AHAEKLLDHACTAl 257 Methylobacterium nod...
jgi:M446_3349     188 VQi-FNPFAELTK-LPg-SSGSLSDVTFAavSATNGv-RgdLYLLAYRQKY-----SAAEKVLDHSCSLT 248 Methylobacterium sp....
Q1LBK3            183 PVlaVDPFDVVREDLg--ADGKIADRGVFlgYVRPLqGQagFVVVDEPVDKAGGANGHASDFLDRGCKLG 250 Cupriavidus metallid...
Q0JZ98            177 PVlaVDPFQLVRDGTKggAAAAPPDRGIFvtYVRERqGGagFVVIDQPVDSAAGSNGHASDFLDRRCRLA 246 Cupriavidus necator H16
bbmufp:Hsero_0296 188 LAq-HDPFKLAAARSAy-AAANMASQSLLltGARFAdGGsgFFLVNMPVNFDLQEQGSAEVLMDHDCRw- 254 Herbaspirillum serop...
jgi:Bphy_3475     183 GAd--DPFRIVARDRq--GSDAMAQQTILvtGAGPTd-KdgWLVVNSGPELDDGS-GSAEPLLDHACEIG 246 Paraburkholderia phy...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap