4F2D


Conserved Protein Domain Family
Arabinose_Isome

?
pfam02610: Arabinose_Isome 
Click on image for an interactive view with Cn3D
L-arabinose isomerase
This is a family of L-arabinose isomerases, AraA, EC:5.3.1.4. These enzymes catalyze the reaction: L-arabinose <=> L-ribulose. This reaction is the first step in the pathway of L-arabinose utilisation as a carbon source after entering the cell L-arabinose is converted into L-ribulose by the L-arabinose isomerases enzyme.
Statistics
?
PSSM-Id: 396945
Aligned: 132 rows
Threshold Bit Score: 419.201
Threshold Setting Gi: 219998794
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4F2D_A               4 FDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKlPCKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTF 83  Escherich...
jgi:SpiGrapes_3064   6 LKEYEFWLLVGSQFLYGIETLEKVAQHAVIIAEGLNTAKQiPCNVVYKATMKTPEEIEKWIKEANYDDSCAGIITWMHTF 85  Sphaeroch...
WP_013607575         6 lATYEFWFVVGSQFLYGKETLEQVAKHAQVMVENMNASSLlPCKLVYKATVKTPEEIEQCVKDANYDDNCAGLITWMHTF 85  Sphaeroch...
CDC68227             1 mENKVFWFVVGSQFLYGPEVLETVDKRAAEMAETMSSSGIlPCKLVYKATVKTDAEITQIMKEANYDDTCCGVVTWCHTF 80  Oscilliba...
BAK98390             2 LKDYEFWFVVGSQFLYGPEVLETVEARAEEMAKKLSDSQQiPCKVAYKVTVKTEAECTKVMKEANADDRCAGVITWCHTF 81  Oscilliba...
CCY39783             1 mKHYEFWFIVGSQTLYGEDVLTTVANRAEEMAQKL--SAVlPYPLKYKVTAKSSAEITQVVKEANYDDSCAGIVTWCHTF 78  Firmicute...
CDC00457             4 IKEYEFWFVTGSQHLYGPETLEQVAKDSQAMVDGLNASGKmPCKIVYKPTVKTPAEIKKVFKEASYDDKCAGVIAWMHTF 83  Firmicute...
CCY67802             3 VQEYEFWFVVGTQFLYGEDIFETINSHAGEMCAEW--SKKmPCRIVAKPCVKTSKEILDLFRAANADDRCAGVITWMHTF 80  Clostridi...
CDC32494             3 IKDYEFWFIVGTQHLYGEEIFADINSHAQDMCDEW--SKKlPCKVVAKPCVKTSSEILNVIEQANNTPNCAGIITWMHTF 80  Eubacteri...
CDC12093             3 MKKKEFWFIVGSQHLYGPEVLETVAVRAAEMAAVIDSSEFiPCRFIYKATVKTTDEVTSIIKEANYDDNCLGIVTWCHTF 82  Clostridi...
4F2D_A              84 SPAKXWINGLTXLNKPLLQFHTQFNAALPWDSIDXDFXNLNQTAHGGREFGFIGARXRQQHAVVTGHWQDKQAHERIGSW 163 Escherich...
jgi:SpiGrapes_3064  86 SPSKMWINGLNLLQKPYCHLHTQFNRNIPDQGIDMDFMNLNQSAHGDREHGFIAARMRLGRKIVVGYWEDEDVQSELGKW 165 Sphaeroch...
WP_013607575        86 SPSKMWIRGLDLLQKPYCHLHTQFNRTIPDTEIDMDFMNLNQSAHGDREHAFIAARMHTKRKIVTGFWEDASVQLKLASW 165 Sphaeroch...
CDC68227            81 SPSKMWIHGFDLLQKPYCHLATQYNRKIPNEEIDMDFMNLNQAAHGDREHGFLGARMRLPRKIIAGYWQDAPVQQELAAW 160 Oscilliba...
BAK98390            82 SPSKMWIHGLGLLQKPWCHFATQYNRHIPNEEIDMDFMNLNQAAHGDREHGFIGARMRLARKIVAGYWEDAPVQKELGDW 161 Oscilliba...
CCY39783            79 SPSKMWINGLDLLQKPWLHFATQYNREIPNEEIDMDFMNLNQAAHGDREHGFIGARLRKPRKIIAGYWQDEDVQARIGSW 158 Firmicute...
CDC00457            84 SPSKMWINGLKDFKKPYCHFHTQFNREIPWNEIDMDFMNLNQSAHGDREHGFIGSRLRMARKVIVGYWEDEEPQTKLANW 163 Firmicute...
CCY67802            81 SPSKAWIAGFNALQKPYLHVNTQYNRDIPWQDIDMDFMNLNQSAHGDREHGYIAARMRLRRKVIAGYWKDETFQKKMETW 160 Clostridi...
CDC32494            81 SPSKMWISGLNALNKPYLHVNTQYNRDIPWDSIDMDFMNLNQSAHGDREHGYIHARMRKKVKVIAGYWKDEQFQNKMGIW 160 Eubacteri...
CDC12093            83 SPSKMWINGLSLLQKPYCHFATQYNREIPNEEIDMDFMNLNQAAHGDREHGFIGARMRLPRKIIMGYWQDEPVLRELGLW 162 Clostridi...
4F2D_A             164 XRQAVSKQDTRHLKVCRFGDNXREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALVDEYESCYTXTPAt 243 Escherich...
jgi:SpiGrapes_3064 166 MRSAIGAIESKNLKVVRFGDNMRNVAVTEGDKVGVQMQLGWQVNTWGVGDLIKEIDNVTESDVDEQVASYRKLYDFATD- 244 Sphaeroch...
WP_013607575       166 MRSAVGAIESRKLKVVRFGDNMRNVAVTEGDKVGVQMQLGWQVNTWGVGDLIRELDQVSEAEVQAQMDIYQNRYVFATK- 244 Sphaeroch...
CDC68227           161 MRAAIGYDFSRRLRIVRFGDNMRDVAVTEGDKVETQIKLGWQVDYWPVGHLVETMDAVTEAEVDAQMEQYKERYDFATD- 239 Oscilliba...
BAK98390           162 MRSAVGVAFSKELRLIRFGDNMRDVAVTEGDKVECEIRLGWQVDYWPVGHLVEVMDAVTEAEIDEKLAEYHARYDFATE- 240 Oscilliba...
CCY39783           159 MKAAIGVAVSKDMKVMRFGDNMRNVAVTEGDKVEVQKKLGWEVNTWAVGDLVKEMNAVTEAEIDELMSVYREKYDFATD- 237 Firmicute...
CDC00457           164 MRSACGYAISQELKMVRFSDNMRQVAVTEGDKVEAEIKFGWDVEYRPIGDIVDILNEVTEAEIDAKMAEYESRYTMDTD- 242 Firmicute...
CCY67802           161 IRAAVGAAESKKVHVLRISDNMRNVAVTDGDKVEAQIKLGWQVDHYGVGDIIREVEAVTEEEIDAQMAEYEKHYIMDTE- 239 Clostridi...
CDC32494           161 MRAAIGASESRKLRVLRISDNMRNVAVTDGDKIEAQIKLGWQVDHYGVGDIIKYVNAVTDDEIDAQMQVYKNNYEFDTD- 239 Eubacteri...
CDC12093           163 MRSAVGYAESRSLKVMRFGDNMRNVAVTEGDKVEVQIKLGWQVNTWAVGDLVKEMAAVGDGEIDGLVDLYKEKYSVCTD- 241 Clostridi...
4F2D_A             244 qihgeKRQNVLEAARIELGXKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLXQQGYGFAGEGDWKTAALLRIXKVXST 323 Escherich...
jgi:SpiGrapes_3064 245 -----NLDSIRYQAKEEIAMRRFLDREGAMAFTNTFEDLQELKQLPGLASQNMMALGYGYGGEGDWKVSAMTALIKRMTE 319 Sphaeroch...
WP_013607575       245 -----DMETVRYQAREEVAMRKFLQREGAYAYTNTFEDLQQMRQLPGLASQDLMAEGYGYGGEGDWKVSAMTSLVKRMTE 319 Sphaeroch...
CDC68227           240 -----DLATVRYQAREEVAMRKILEREGAQAFINNFQDLYGMEQLPGLASQNMMADGIGYGGEGDWKVAGMTAIMKKMAQ 314 Oscilliba...
BAK98390           241 -----DLDSVRYQAKEELAIRKIMEREGARGFINSFQDLYGMRQLPGLASQNIMADGMGYGAEGDWKVSGMTAIVKAMSE 315 Oscilliba...
CCY39783           238 -----DINAIRYQAREEIAMKKMMDAEGCKAFSNTFQDLYGMEQLPGLASQHLMAQGYGYGGEGDWKVAAMTAILKAMGE 312 Firmicute...
CDC00457           243 -----NIDAVRYQAKEEIAIRKMCEQFDYSAFVTHFDTLHGLDQLPGLAAQNMMADGYGFGAEGDWKVAAMDVIMKSMAE 317 Firmicute...
CCY67802           240 -----NIEAVRYQAREEVAIKKFMDRYAFNAFHTNFEDLQGLRQLPGLAAQDLMRQGYGFGAEGDWKVAALLRVMTSMAE 314 Clostridi...
CDC32494           240 -----NIDSVRYQAREEVAIKKFLDENGFGAFHTNFEDLQELRQLPGLAAQDLMRQGYGFGAEGDWKVAAMTRIMKLMAE 314 Eubacteri...
CDC12093           242 -----NIEAIRYQAREEIAIKRMLDREGAKAFTNTFEDLYGMEQLPGLASQRLMEQGYGYGGEGDWKVAAMTRIVKAMTE 316 Clostridi...
4F2D_A             324 GlqGGTSFXEDYTYHFEKGNDLVLGSHXLEVCPSIA 359 Escherichia coli K-12
jgi:SpiGrapes_3064 320 GmgGGTAFMEDYTYDLEKGKELSLGAHMLEVCPSLs 355 Sphaerochaeta pleomorpha str. Grapes
WP_013607575       320 GmgKGTTFMEDYTYHMEKGNELSLGAHMLEICPSIT 355 Sphaerochaeta globosa
CDC68227           315 GleGGTLFMEDYTYDLEPGKEVSLGAHMLEVCPSIA 350 Oscillibacter sp. CAG:155
BAK98390           316 GlkGGSAFMEDYTYDLEPGKEISLGAHMLEVCPSVA 351 Oscillibacter valericigenes Sjm18-20
CCY39783           313 NgnGASAFMEDYTYHLVKGQEYSLGAHMLEVCPSVA 348 Firmicutes bacterium CAG:124
CDC00457           318 GmtGGTAFMEDYTYHLEKGNEHILGAHMLEVCPLVA 353 Firmicutes bacterium CAG:41
CCY67802           315 GldGGTVFMEDYTYHFEPGNEMLLGSHMLEVSPQCA 350 Clostridium sp. CAG:678
CDC32494           315 GmnGGTAFMEDYTYHFEPGNEMLLGSHMLEVCPTIA 350 Eubacterium sp. CAG:251
CDC12093           317 GmgGGSGFMEDYTYHLLPGSEYSLGAHMLEVCPTLA 352 Clostridium sp. CAG:413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap