6JO6,6HQB


Conserved Protein Domain Family
PsaL

?
pfam02605: PsaL 
Click on image for an interactive view with Cn3D
Photosystem I reaction centre subunit XI
This family consists of the photosystem I reaction centre subunit XI, PsaL, from plants and bacteria. PsaL is one of the smaller subunits in photosystem I with only two transmembrane alpha helices and interacts closely with PsaI.
Statistics
?
PSSM-Id: 396940
Aligned: 52 rows
Threshold Bit Score: 141.559
Threshold Setting Gi: 504967900
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6JO6_L             7 NGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPeTAEIAGSLSAAGLVL 86  Chlamydomon...
jgi:GEI7407_1160   9 AGDPQVGHLATPISASGFTKALINNLPAYRAGLSPNRRGLEVGMAHGYLLFGPFALLGPLRDSD-VPYLAGLLGAIGLVV 87  Geitlerinem...
WP_012161996       9 GGDPLVGDLATPVNSSGIVKAWINNLPAYRKGMSANARGLEIGMAHGYYLYGPFATSGPIRGTT-MSLVSGVLSASAVVI 87  Acaryochlor...
Q54753             7 GGDPQVGNLATPINASAFSKAFINNLPGYRQGLSAQRRGLEVGMAHGYFLYGPFALLGPLRNAD-FAGVAGLLGTVGLIS 85  Synechococc...
jgi:PCC8801_3982   9 GGDPQVGNLATPLNSSGFSLAFIRNLPAYRKGLSANRRGLEVGMAHGYFLYGPLAILGPLRSTD-YAATAGLLATVGLVS 87  Rippkaea or...
B1WPZ7             7 RGDPQIGNLATPVNSSRLSLAFIRNLPAYRRGLSANRRGLEVGMAHGYFLYGPFAILGPLRNTE-YASTGGLLSAVAMIS 85  Crocosphaer...
WP_015220962       9 GGDPQVGNLSTPINGSAFTKAFINALPAYRKGLSPNRRGLEVGMAHGYLLYGPFAVLGPLRLTE-YGPTAGLLATIGLVS 87  Cyanobacter...
WP_015109435       6 VADPTVGNLATPVNSSYFTKAFLNALPAYRPSLSPNRRGLEVGMAHGYLLYGPFAYTGPLRATE-FASTAGLLATIGLVS 84  Cyanobium g...
Q7V512            31 AADPCVGNLATPVNSGYFVKALVNNLPLYREGISANFRGLETGAAIGYFIYGPFLVMGPLRTTD-FATTAALLATVGAVH 109 Prochloroco...
WP_011936568       6 AADPCVGNLATPVNSGYFIKALINNLPFYRAGISPNFRGLETGAAFGYLLYGPFTICGPLRNSE-FSATAGLLAAIGAVH 84  Synechococc...
6JO6_L            87 ILALCLSIYGSAQfQSTpsiGVktlsgrsvarDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQIL 152 Chlamydomonas reinhardtii
jgi:GEI7407_1160  88 ILTICLSLYGSVG-VGKpiatvt----tpnppADLGSSEGWSEFASGFLIGGIGGALFAYALTANL 148 Geitlerinema sp. PCC 7407
WP_012161996      88 VLSVAIQIYSSVS-SAKplpsvt----tadpgSDFGTKEGWSAVGSGFLIGGCGGAVIAGVLSYai 148 Acaryochloris marina
Q54753            86 LLTLALSLYGSVG-VSTptatlt----tpnppENLGTKEGWSEFAAGFLIGGCGGALVAYGLCIAL 146 Synechococcus sp. PCC 7002
jgi:PCC8801_3982  88 ILTIALSMYASVG-VTKptetlt----tpevpEDLGTSEGWGEFANGFFIGGCGGAFFAYLLCQTP 148 Rippkaea orientalis PCC 8801
B1WPZ7            86 ILTIALSLYASVE-VGKpietlt----tpdvpEDLGTSVGWGEFANGFFIGGSGGVIFAYLLCQAL 146 Crocosphaera subtropica A...
WP_015220962      88 ILTICLSIYGAVG-VSKptetlt----tpevpMDLATKEGWSEFAGGFLLGGCGGAFFAFFLCQTP 148 Cyanobacterium aponinum
WP_015109435      85 ILTICLSIYGTAG-SGPnvqPPdati--dnppADLFTKAGWAEFASGFWLGGCGGAAFAWFLCSTA 147 Cyanobium gracile
Q7V512           110 ILTALLVLYNVPG-KAPtvpPPdvtv--anppADLFTRKGWADFTSGFWLGGCAGAAFAWFLCNTL 172 Prochlorococcus marinus s...
WP_011936568      85 ILTLLFLLYNQPG-KQPhipMAdvti--dnppADLFTRTGWADFTSGFWLGGCGGAVFAWFLCGTL 147 Synechococcus sp. RCC307
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap