3EGO,5ZIK,2EW2,4OL9,2QYT


Conserved Protein Domain Family
ApbA

?
pfam02558: ApbA 
Click on image for an interactive view with Cn3D
Ketopantoate reductase PanE/ApbA
This is a family of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, EC:1.1.1.169. The reaction catalyzed by this enzyme is: (R)-pantoate + NADP(+) <=> 2-dehydropantoate + NADPH. AbpA catalyzes the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway. ApbA and PanE are allelic. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway.
Statistics
?
PSSM-Id: 396899
Aligned: 80 rows
Threshold Bit Score: 60.7115
Threshold Setting Gi: 121732284
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EGO_B   5 IGIIGGGSVGLLCAYYLslYHd---------VTVVTRRQeQAAA-IQSEGIRLYKGG---------EEFRADcsadtsIN 65  Bacillus subtilis
Q89LE0   3 VLVIGAGALGGYYGACL--ARag------gdVTFLVRPA-RAEQ-LRRDGLQVVSPHgdfa-vqpkIILASD------LK 65  Bradyrhizobium japonicum
Q89WT9   3 ILVVGAGAIGGYFGGRL--LQag------rdVTFLVRPR-RAGE-LASAGLVIKSPNgdvt-lkapPTVEADk-----LK 66  Bradyrhizobium japonicum
Q6NDT4   3 ILIVGAGAIGGYFGGRL--LQlg------rdVTFLVRPG-RAAE-LTRDGLVIKSPHgdat-iqnpPAVQAAa-----LT 66  Rhodopseudomonas palu...
Q8Y307   3 ILVLGAGGTGGYFGGRL--TQag------adVTFLVRPA-RAAR-LREHGLEIRSPLgdar-fpvqVITAGEt----aAW 67  Ralstonia solanacearum
Q8P3T9   3 ILILGAGGTGGYFGGRL--AQag------vdVTFLVRDA-RAAQ-LQAQGLRIRSPLgdad-lpvaTVTAQDlqa-lvAQ 70  Xanthomonas campestri...
Q9KC11   3 FLIVGAGAVGGYFGARL--AEkg------edVTFLVREK-RKEQ-MKKRGLRIQSIHgntt-iqakTITMED-------T 64  Bacillus halodurans
O31717   3 FLVVGAGGVGGYIGGRL--SEkg------ndVTFLVRQK-RAEQ-LKKTGLVIHSEKgnvs-fqpeLISAGE-------T 64  Bacillus subtilis sub...
2QYT_A  11 IAVFGLGGVGGYYGAXL--ALraaatdglleVSWIARGA-HLEAiRAAGGLRVVTPSrdfl-arptCVTDNPa-----EV 81  Porphyromonas gingiva...
Q8A338   3 YLIAGTGGVGGSIAGFL--SLag------kdVTCIARGA-HLQA-IQKDGLKLKSDLkgehtlvipTMNAEE------FN 66  Bacteroides thetaiota...
3EGO_B  66 SDFDLLVVTVKQHQLQSVFSSLERIGKTN--ILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTG-LGAI 142 Bacillus subtilis
Q89LE0  66 EPFDVVLVGVKSYSLDDAMAQFAPAVGANtmILPILNGLKHIDALTARFGAARVLGGLANVSAGLDADGRVVQFMaNQTI 145 Bradyrhizobium japonicum
Q89WT9  67 DKFDVVLLSCKAFDLDDAIKSFAAAVGPDtaIIPMLNGMKHLDTLDARFGKERVLGGLCAIAATLSEKREVVQLQpMQAI 146 Bradyrhizobium japonicum
Q6NDT4  67 PDYDLVVLSCKAFDLDDAIASFRGGVGPRtaILPLLNGMKHLDVLDTAFGRDRVLGGQCVIAATLDAQRHVVQLApMSAI 146 Rhodopseudomonas palu...
Q8Y307  68 GHADLVLLSCKAYDLDDAIAAIRPAVGERtaVLPVLNGLSHLDRLDAAFGAARVLGGLCHISAASAPDGAVLHLTpLHSI 147 Ralstonia solanacearum
Q8P3T9  71 RPFDLVILSCKAYDLDSAIEAIAPAVGEHttVLPILNGLRHYAALDERFGAARVLGGLCFISAAKGEHGEILHLGkPAAM 150 Xanthomonas campestri...
Q9KC11  65 GLFDVVLLGTKAYHLENVIETIRPFIHDQtvIIPMLNGIAHLDRLRKAFSTEQVIGGLCFIESTLNEFGDIVQTSqIHRF 144 Bacillus halodurans
O31717  65 GQFDVVIIASKAYSLGQVIEDVKPFIHQEsvIIPFLNGYRHYEQLFAAFSKEQVLGGLCFIESALDNKGEIHHTSaSHRF 144 Bacillus subtilis sub...
2QYT_A  82 GTVDYILFCTKDYDXERGVAEIRPXIGQNtkILPLLNGADIAERXRTYLPDTVVWKGCVYISARKSAPGLITLEAdRELF 161 Porphyromonas gingiva...
Q8A338  67 GKADVIFVCVKGYSVDSITELIKRASHEKtvVIPILNVYGTGPRIQRLVPGVTVLDGCIYIVGFVSGTGEITQMGkIFRL 146 Bacteroides thetaiota...
3EGO_B 143 KWSAFDD 149 Bacillus subtilis
Q89LE0 146 VFGEIKG 152 Bradyrhizobium japonicum
Q89WT9 147 SYGERDG 153 Bradyrhizobium japonicum
Q6NDT4 147 TFGERDG 153 Rhodopseudomonas palustris
Q8Y307 148 TFGERDS 154 Ralstonia solanacearum
Q8P3T9 151 TFGERDG 157 Xanthomonas campestris pv. campestris
Q9KC11 145 VFGELNG 151 Bacillus halodurans
O31717 145 VFGEWNG 151 Bacillus subtilis subsp. subtilis str. 168
2QYT_A 162 YFGSGLP 168 Porphyromonas gingivalis W83
Q8A338 147 VYGAHKG 153 Bacteroides thetaiotaomicron
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap