5ZHW,4OX3,4OX5,4JID


Conserved Protein Domain Family
VanY

?
pfam02557: VanY 
Click on image for an interactive view with Cn3D
D-alanyl-D-alanine carboxypeptidase
Statistics
?
PSSM-Id: 396898
Aligned: 45 rows
Threshold Bit Score: 123.111
Threshold Setting Gi: 81620207
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZHW_A  66 GERIDIRISPYLQDLFDAARADGVYPIVASGYRTTEKQQEIX--DEKVAeykak---------gytsAQAKAEAETWVAV 134 Enterococcus faecalis...
Q8EEB5  50 RFKLESQTALAFQAMADSAAKDGIKLAICSAYRPFDRQLAIWnaKASGKrvvldineqpvditplseSELVDLILLWSAL 129 Shewanella oneidensis
Q5QTZ2  20 GHKLHPDAAEAYLAMQKAAAAEGIELAIASGFRSLDRQLSIWnrKWRGKlplrskegelldasnlsdVEKMHAILHWSSL 99  Idiomarina loihiensis
Q7N3J3  21 NHRLQPEAANAFFSMQQAAEKAGINLQPASTFRDFQRQQAIWngKFRGErpvldensqpmditqlseGERCKAILRWSAL 100 Photorhabdus laumondi...
Q7VNB4  28 NHYLQAEVVTAFLGLQHAAKRADFNLQPASTYRDFNRQMLIWnaKFNGKrkihndaskqidittltdLAKIKAILRWSAV 107 [Haemophilus] ducreyi
Q9CM23  28 HHFLHQDCLVAFQCLQQSAAKHGFNLQPASSFRDFQRQQAIWnaKFYGErkvhddqgnpldlstlsdWEKVQAILRWSAL 107 Pasteurella multocida
Q6D7N5  20 HHRLQPEAVTAFLALQHAAKTVGFNLQPASTFRDFERQRQIWnsKFRGEravmdansqpldisslddGERCEAILRWSAM 99  Pectobacterium atrose...
Q6LTW9  50 QHLLHKDMQPAFAALQQAAQLAGFDLQLASAFRPFERQLLIWnnKFNGLrplldsnsqpldasalskLEKIEAILRWSAL 129 Photobacterium profundum
Q87MI5  23 AFLMHPDVANDLLNMIEAAKKAGFKMEIASGFRDFSRQRAIWngKYEGElpildsnsqplnkaalsdEEKLKAILRWSAL 102 Vibrio parahaemolyticus
Q65US8  26 NHFLQPQALKAFQALQKSAVKNGFNLQPASTFRDFARQQLIWngKFNGErkvhddqgnpldltalscWEKAQAILRWSAL 105 [Mannheimia] succinic...
5ZHW_A 135 PGTSEHQLGLAVDINAD------------------GIHSTGNEVYRWLDENSYRFGFIRRYPpDKTEITGVSNEPWHYRY 196 Enterococcus faecalis...
Q8EEB5 130 PGASRHHWGTDIDVFDAekievksl---rlveaeyRDGGPCAQLHQWLVANAKDFGFYFPFQrGQSA---VSAEPWHISY 203 Shewanella oneidensis
Q5QTZ2 100 PGSSRHHWGSDFDIYDPrpfqdselklqlvpgeyiDQSGPCHELWQWLTRHAHESGFFFPYA---RYQGGVAQEPWHLSF 176 Idiomarina loihiensis
Q7N3J3 101 PGGSRHHWGTDLDVYDPtmlpanqm--lllepweyENGGYFAPLTHWLTENMAHFGFYRPFV-GNCGS--VADEPWHISY 175 Photorhabdus laumondi...
Q7VNB4 108 PGASRHHWGTEIDIFDPdllpqgqh--lqlepweyQSNGYFAPLIKWLHQHSASFGFY--FPfDGIQNSQVGEEPWHLSY 183 [Haemophilus] ducreyi
Q9CM23 108 PGGSRHHWGTEIDVFDPhllpphqt--lqlepweyEQGGYFFELSDWLQQNLAHFDFALPFT-QLSQDKEIGYEPWHISY 184 Pasteurella multocida
Q6D7N5 100 PGSSRHHWGSDLDIYDPdllpagss--lqlepweyEEGGYFAALNGWLSAHMHEYGFYRPYA---HDLGGVAVEPWHISY 174 Pectobacterium atrose...
Q6LTW9 130 PGASRHHWGTDVDVYAKnclpvnts--lqlepweyQTNGHQAEFNQWLSAHMGEYGFYLPYA---EDKGGVALEPWHISY 204 Photobacterium profundum
Q87MI5 103 PGGSRHHWGCDFDVYARnllppdtk---lqlepweYLEGHQLAFYCWLKDHIDEFGFFFPYL---QDLGGVAIEPWHISH 176 Vibrio parahaemolyticus
Q65US8 106 PGASRHHWGTEIDFFDPdllpqhqq--lqlepweyEQDGYFFELSRFLQQNLPQFDFVLPFM-QTPKGKEIGREPWHISY 182 [Mannheimia] succinic...
5ZHW_A 197 VGI 199 Enterococcus faecalis V583
Q8EEB5 204 FPV 206 Shewanella oneidensis
Q5QTZ2 177 RAV 179 Idiomarina loihiensis
Q7N3J3 176 QPF 178 Photorhabdus laumondii subsp. laumondii
Q7VNB4 184 RPI 186 [Haemophilus] ducreyi
Q9CM23 185 LPI 187 Pasteurella multocida
Q6D7N5 175 YPL 177 Pectobacterium atrosepticum
Q6LTW9 205 HPI 207 Photobacterium profundum
Q87MI5 177 KAI 179 Vibrio parahaemolyticus
Q65US8 183 LPL 185 [Mannheimia] succiniciproducens MBEL55E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap