1FX3


Conserved Protein Domain Family
SecB

?
pfam02556: SecB 
Preprotein translocase subunit SecB
This family consists of preprotein translocase subunit SecB. SecB is required for the normal export of envelope proteins out of the cell cytoplasm.
Statistics
?
PSSM-Id: 396897
Aligned: 173 rows
Threshold Bit Score: 152.219
Threshold Setting Gi: 123736461
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FX3_A        12 EEQQPVLQIQRIYVKDVSFEAPNLPHIFqqEWKPKLGFDLSTETTQVGdDLYEVVLNISVETTLEDsgDVAFICEVKQAG 91 
Q9EZ97        13 TDHLPQVSILAQYIKDLSFENPNAPAVYqwQTQPHIEVQFNIGTQPMAqDVYEVALKVDVSAKADE--GVVFHVELVYNG 90  Zymomonas mobil...
A5VD08        15 EDHLPQVALIAQYVKDLSFENPSAPGIYqaPEQPKIDVQFNIGSQQAGeDVYEVALKIEIKATQGD--LTAYAVELVYAG 92  Sphingomonas wi...
WP_015459758  18 edNLPQVALIAQYVKDLSFENPNAPAVYqwQGQPQIDVQFNIRADTLGeDVHEVALKIDVTAAADQ--GVAFKADLLFAG 95  Sphingomonas
WP_013039321  15 ADNGPQIALISQYVKDMSFENPNAPAVYqwQDQPQIDVQFNIGADKVGeEVVEVSLKIEVKATAPQ--GTAFAVELVYAA 92  Sphingobium jap...
WP_014074370  10 ADNQPQIGLIAQYVKDLSFENPNSPAVYqwQEQPQIDVNFNISNNKVAdDVFEVALKVSATAAGEA--GTAFAVELVFAG 87  Sphingobium sp....
Q1GRJ6        19 edTSPAIGLISQYVKDLSFENPNAPAVYqwQGAPQVDVQFNIAADSVGdNLYEVLLKIDVTSKTDK--GTSFVIELKYAG 96  Sphingopyxis al...
WP_025290164  18 ADTTPQVGVISQYVKDLSFENPNSPAVYqwQGQPRIDVQFNIGSQAVAdDVFEVVLKIEVRADTDN--GVAFLVDLSYAG 95  Sphingomonas sa...
Q2N7Z9        22 adnRPTAGFITQYIKDMSVENPNAPGVYqwQEQPQIDLQFNIGANAVNeEVTEVELKINVEAKTDQ--GALYIIELVYAG 99  Erythrobacter l...
WP_007012233  17 edtGPSAGIITQYVKDLSVENPNSPQSFqwQDQPQVDIQFNIGARPIDgEVHEVELKITCTSKAEA--GTAYVVDLSYCA 94  Novosphingobium
1FX3_A        92 VFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYM 150
Q9EZ97        91 LFAIKNVPADQIQPFLYIEAPRILFPFVRRILADSVRDGNFPPLMLEPIDFAALYMQQT 149 Zymomonas mobilis subsp. mobilis ZM4...
A5VD08        93 LFGIRNVPEEHLPPFLLAEAPRLLFPFARRVAADAIRDGNFPSLVLEPIDFGALYMQQA 151 Sphingomonas wittichii RW1
WP_015459758  96 LFGIRNVPQDQLQGFLLAEAPRLLFPFARRVLADAVRDGNFPPLMLEPIDFGALYLQQQ 154 Sphingomonas
WP_013039321  93 IFGMRNVPEDQMQPFMLAEAPRLIFPFARRVLADAIRDGGFPPLLLDPIDFGGLYIQQA 151 Sphingobium japonicum
WP_014074370  88 LFGMRNVPEEQMRPFLYAEAPRLLFPFARRILADAVQDGGFPPLLLDPIDFGALYMQQQ 146 Sphingobium sp. SYK-6
Q1GRJ6        97 LFGVRNVPDDQLQPFFLAEAPRILFPFARRVVADAVQDGGFPALLLEPIDFHGLFMQQV 155 Sphingopyxis alaskensis RB2256
WP_025290164  96 LFGLRNIPADQLQPFLLAEAPRIIFPFARRILADTVRDGGFPPLMLEPIDFTGLYLQQA 154 Sphingomonas sanxanigenens
Q2N7Z9       100 LVGIRNLGDDQAHMFVYAEAPRILFPFARRVIADATRDLGFQPLMLDPIDFNGLYMQRL 158 Erythrobacter litoralis HTCC2594
WP_007012233  95 LVGMRNLDEGQAHAFLFAEAPRILFPFARRVVSDAVRDAGFAPLMLEPIDFNGLYVQQL 153 Novosphingobium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap