Conserved Protein Domain Family
CstA

?
pfam02554: CstA 
Carbon starvation protein CstA
This family consists of Carbon starvation protein CstA a predicted membrane protein. It has been suggested that CstA is involved in peptide utilisation.
Statistics
?
PSSM-Id: 396896
Aligned: 46 rows
Threshold Bit Score: 367.303
Threshold Setting Gi: 500019619
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KBY1            3 GVLLAALGMLVFALGYRYYSKFIAERIYRLDPNFVTPAHQFKDGKDFVPTNKFVLWGHHFTSVAGAAPIVGPAIAI-YWG 81  Bacillus hal...
jgi:Glov_2387     3 ALTLVFVALCVFALAYRYYGLFIANKVLNLQAERATPAVTQADGHDYVATNKYVLFGHHFAAIAAAGPLLGPVLAA-QFG 81  Geobacter lo...
WP_012646142      3 ALTLIFTSLCVFAIGYRFYGLFIARRVMALNDDRPTPAVTLADGHDYVKTDKYVLFGHHFAAIAAAGPLLGPVLAA-QFG 81  Geobacter da...
jgi:Desti_4722    3 SMVVLIVGFVVAVIGYRFYARYIDSKVIQADSKRMTPARMYMDGVEFMPTSKNILYGYQFKSIAGAGPIIGPIIAI-QWG 81  Desulfomonil...
Q1QW04            3 AIWIALFGAVCFVMGYRFYSKFIAERIYRLDADFQTPAHAYRDGVDYVPTNKWILWGHHFTSVAGAAPIVGPAIAI-YWG 81  Chromohaloba...
WP_013638614      2 vtFLFLLSISIFIIAYFTYGKFLSKKVFKLDDKNKTPAHTMKDGVDYVPAPAPVLLGHHFSSIAGAGPIVGPITAAsSWG 81  Desulfurobac...
CBRAS:MROS_2222   3 GIILVVFAIILFISAYRIYGNFISNK-FSIDGNHTTPSHEMYDGVDYVPAKPPVLLGHHFASIAGAGPIVGPIIAA-SFG 80  Melioribacte...
jgi:Anamo_0331    3 GVMLMLVTFVLFILAYIFYGGWLAKQ-WGLNPQGKTPAHEFYDGVDYVPAKAPVLLGHHFASIAGAGPINGPVLAA-VFG 80  Acetomicrobi...
WP_022092840      3 GLLLLGIAAVLFICAYVFYGRYLVKT-WGIDVNADTPAKTYEDGEDFVPSNKWKVFAHQFSSIAGAGPVTGPVMAL-MFG 80  unclassified...
WP_011700337      3 AAVLMVVAFVLFFIAYRIYGKYISKV-FEENDANPTPACAMKDDCDYVPTKPIVLFGHHFASIAGGGPIIGPTVAM-LFG 80  Syntrophobac...
Q9KBY1           82 WLPAILWVTLGTVFAAGVHDFGALVLSVRNKGQSVGTLADKLIGRQAKLLFLFIILILVLMVNAVFAWVISNLF------ 155 Bacillus hal...
jgi:Glov_2387    82 FLPGALWIIIGAVVAGAVHDMIVLFASVRHRGKSLSRIAEVEIGTVIGKVASVAILFILILTLAGLAIAVVNAM------ 155 Geobacter lo...
WP_012646142     82 FLPGALWIIIGAVVAGAVHDSIVLFASIRHKGKSLSAIAGAEIGNVAGKVASIAILFILILTLAGLSIAVVNAM------ 155 Geobacter da...
jgi:Desti_4722   82 WLPALIWILAGTFFIGWVHDYSSAVIAMRNDGASFGGLSHRLISPRARLILLSFIYFYLLLIVGAFGNVVVSTA------ 155 Desulfomonil...
Q1QW04           82 WLPAILWVVLGTVFAAGVHDFGAVVLSNRHKGHSIGTLANKLIGQRAKLLFLFIILILVLMVNAVFAWVIAKLF------ 155 Chromohaloba...
WP_013638614     82 WLPAFLWVLIGNVFIGGVHDMSSLVASIRNKAKSIAEIGGMYLTKRAGIIFKLFIWLALLYVVAVFINVAQITFnskipi 161 Desulfurobac...
CBRAS:MROS_2222  81 WAPVYAWILIGSTFIGGVHDYTALIASIRHKGKTIGQVIENYIGLNGKKLFLIFTWSTLILVIAVFTIIVSNTF------ 154 Melioribacte...
jgi:Anamo_0331   81 WLPVTLWIVVGNIFMGAPHDFGSLMASIRHKGLSIGGVIEVNVGKGAKRLFLLFSWLTLVLIIAAFANIVADTF------ 154 Acetomicrobi...
WP_022092840     81 WLPAVLWIVIGGIFFGAVHDFGALYASVKSKGQSMGKIVEDNIGKTGKKLFFLFCWLFSLIVIAAFADMVSGTFngfnaq 160 unclassified...
WP_011700337     81 FIPVWLWAVFGSIFVGAVHDMTTLFASVREKGKSVAEIAKATLGNTGFFLFISFNILMLLLVTSAFLGLTATALtsllpl 160 Syntrophobac...
Q9KBY1          156 -----------------------ISNPSAVLSVFIQIPLAVWIGYHVYKRQGG-MLIPSLVALAVMYVSAIVASRV---- 207 Bacillus hal...
jgi:Glov_2387   156 -----------------------YNSPWSTFTVVCTIPIALIMGLYLHVIRPGdVKGASVIGVVLLFIAILAGPQVvanp 212 Geobacter lo...
WP_012646142    156 -----------------------FASPWGTFTVFCTIPIAMVMGIYMHNIRPGdVKGASVIGVLLLLLSVLAGPYVaanp 212 Geobacter da...
jgi:Desti_4722  156 -----------------------VTLKAAPMAWLFLTIAGVLCGQMIYRWKRD-IILTTVVTVLIAMIGIYLGRWIpsds 211 Desulfomonil...
Q1QW04          156 -----------------------ITFPASVLSVFIQIPLAVWIGYRVYRHSGS-MLLPSVIALAVMYGAALLASEI---- 207 Chromohaloba...
WP_013638614    162 ie-------------ggkvvemmPIGGGVATSAIIYIFLAVIFGFIVYHKKKS-LGITTAIFVVLVYLAVYIGQLF---- 223 Desulfurobac...
CBRAS:MROS_2222 155 -----------------------NSIPSAGTASILFIVIAIAFGLLSYRKKIP-LLISSAVGIVLLALAIYFGNQF---- 206 Melioribacte...
jgi:Anamo_0331  155 -----------------------VSTPQAATSSLLFIPLAMAFGFAIYRRNAP-LLISTIVGVAILALCIWLGVLF---- 206 Acetomicrobi...
WP_022092840    161 ------------------tgakaVANGSAASISIFYVFGAILFGYITRKLDVK-GWKQVVLGIVFVVVMLALGIKF---- 217 unclassified...
WP_011700337    161 dvlklepsqtlvktieaggvvkaQIGGIASTSVIIITCCAPFLGFLVYKKGIN-AYLASAIAIVVCIVSVVVGMEI---- 235 Syntrophobac...
Q9KBY1          208 ----PAlqidliryfggeenivafgldgvAMSFFVWIIVLMIYVYIASTLPVWKLLQPRDYINSHQLVVGLLILYL---- 279 Bacillus hal...
jgi:Glov_2387   213 tlaaMF-----------------------TFSKKQIALMIPVYGFFASVLPVWLLLCPRDYLSTYLKIGTIVALAL---- 265 Geobacter lo...
WP_012646142    213 tlasLF-----------------------TFSKKEIALIIPIYGFFASVLPVWFLLVPRDYLSTYLKIGTIVMLAL---- 265 Geobacter da...
jgi:Desti_4722  212 ilgaDL-----------------------AGSRVLWAIAAFVFCYFAAVLPIWRFALPINYVAAYIVFLGLLFGII---- 264 Desulfomonil...
Q1QW04          208 ----PLlqidlvswfggaeapvvggfngtSMAFLVWIVVLMTYVYIASTLPVWKLLQPRDYINSHQLVVGLALLYL---- 279 Chromohaloba...
WP_013638614    224 ----PI-----------------------NLSPEAWNIIMILYVAIASITPVWILLQPRDYLSSFLLYGAVLGAGL---- 272 Desulfurobac...
CBRAS:MROS_2222 207 ----PL-----------------------LLSKQAWIVILLVYIFFASVTPVWILLQPRDYLNSFLLYALMLGGIA---- 255 Melioribacte...
jgi:Anamo_0331  207 ----PL-----------------------ALSKTAWLIILSIYIIAASILPVWILLQPRDYLNSFLLYAMIIGGFL---- 255 Acetomicrobi...
WP_022092840    218 ----PV-----------------------FLGKQAWTYIVFVYIFFAAITPIALMKQPRDYLTTFLFVGMIVAAML---- 266 unclassified...
WP_011700337    236 ----PV-----------------------SFNANTWMIILCFYTLLAAGIPVWLILQPRDFTNSFLLYAGVAGLFIasia 288 Syntrophobac...
Q9KBY1          280 ----GLLF--SNPKVTAPA-----VNGSPDT---SWFPLLFITIACGAISGFHGLVSSGTTSKQLNKETDARFVGYLGAI 345 Bacillus hal...
jgi:Glov_2387   266 ----GIAV--VHPDLQMAPlt-kyTGGGGPVipgAVFPYIFITIACGALSGFHAIIGTGTTPKMISNERDVLFVGYGAML 338 Geobacter lo...
WP_012646142    266 ----GIVA--VHPQLQMPAit-qfAGGGGPVipgAVFPFIFITIACGALSGFHAIIGTGTTPKMIARERDVLFVGYGAML 338 Geobacter da...
jgi:Desti_4722  265 ----GIFV--LRPDFTLPAyt------sfDIkigPLWPIMFVTIACGAISGWHSIVSSSGTARQLENELDARPVGAGVMF 332 Desulfomonil...
Q1QW04          280 ----GLLF--GAPEMTAPS-----VNGEADI---SWYPLLFITIACGAISGFHGLVASGTTSKQLDKETDARMVGYGGAL 345 Chromohaloba...
WP_013638614    273 ----GIILsfGKVDVNIPAymgfnSD-Ig-----PLVPLLFVVIACGSISGFHSLVGSGTTSKQLDKETDAVKVGYGAML 342 Desulfurobac...
CBRAS:MROS_2222 256 ----GLFF--TMPEVHLAPvtnfnINKIg-----YLFPALFVTVACGAISGFHSIVSSGTTAKQLDKETDAKLIGYGGML 324 Melioribacte...
jgi:Anamo_0331  256 ----GVIL--YHPTISMPAvtafkHPTQg-----YLFPMLFITIACGAISGFHSLVASGTTAKQLDREGDAKIIGYGGML 324 Acetomicrobi...
WP_022092840    267 ----GIVV--SNPTITTPAftgfkTQTGs-----YLFPTLFVTIACGAVSGFHSLVSSETSSKQIANEKDMLQVGYGSML 335 unclassified...
WP_011700337    289 agfkGVTF--NAPLTNLAA---------GSAklgPIWPFLFITVACGAISGFHCLVAGGTSSKQISKESDVRRIGYGGML 357 Syntrophobac...
Q9KBY1          346 GEGLLALIVIVAVATFfaSPQAF-----SEVYSSFGAAnqgglGNFVQ 388 Bacillus halodurans
jgi:Glov_2387   339 TEGFVAIMALIAACVL--VPADY-----FAINTTPAIFqk--lGMATV 377 Geobacter lovleyi SZ
WP_012646142    339 TEGFVAIMALIAACTL--VPADY-----FAINSAPKAFea--lGMTPV 377 Geobacter daltonii
jgi:Desti_4722  333 LEMMLALFALIIAGTIyaSANEY----------AAAVA-----AGPAR 365 Desulfomonile tiedjei DSM 6799
Q1QW04          346 GEGMLAMIAIIAVGTLfaSGTDF-----TATYSSFSAAgsnglGSFVk 388 Chromohalobacter salexigens DSM 3043
WP_013638614    343 LEGIVAVMSIIFVIVL--SSSEF-----EILKKNVAAiygegigkfln 383 Desulfurobacterium thermolithotrophum
CBRAS:MROS_2222 325 IEGVLAVLALLSVASL--DQAHF--------------IqllneKGAVT 356 Melioribacter roseus P3M-2
jgi:Anamo_0331  325 IEGALAILATITAVYL--TADGYael---------------lkGGPVN 355 Acetomicrobium mobile DSM 13181
WP_022092840    336 LESMLAIVVIVVVGSL--PSLAHs----GVLNNALSSValadtATPFQ 377 unclassified Firmicutes sensu stricto (misce...
WP_011700337    358 LEGLLAIGVLVAVG----CGIAFqdysnIVFPTTAGVR-----SNPIL 396 Syntrophobacter fumaroxidans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap