1YEW,6CXH


Conserved Protein Domain Family
AMO

?
pfam02461: AMO 
Click on image for an interactive view with Cn3D
Ammonia monooxygenase
Ammonia monooxygenase plays a key role in the nitrogen cycle and degrades a wide range of hydrocarbons and halogenated hydrocarbons.
Statistics
?
PSSM-Id: 426783
Aligned: 7 rows
Threshold Bit Score: 369.809
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YEW_J     8 VRSHAEAVQVSRTIDWMALFVVFFVIVGSYHIHAMLTMGDWDFWSDWKDRRLWVTVTPIVLVTFPAAVQSYLWERYRLPW 87  Methylococcus capsu...
Q3J891     8 VRTPEEAAKVSRTLDFIALGAFFMILLASHHVHVMLLMGDWDFWVDWKDRRFWVTVVPIVSVAYPAAAQAFFWEKFRLPF 87  Nitrosococcus ocean...
Q2YAW5    11 AKMPPEAVKMSRMIDVIYFPILCILLVGTYHMHFMLLAGDWDFWLDWKDRQWWPVVTPIVGITYCAAIMYYLWVNYRLPF 90  Nitrosospira multif...
6CXH_B     8 VRSRAEAVKVSRTFDYMILFTVFFVVLGGYHIHYMLTGGDWDFWTDWKDRRLWVTVAPIVSITFPAAVQAVLWWRYRIAW 87  Methylotuvimicrobiu...
Q6MZ17    15 WKSKEEFLGCVILTDWILLVILFAVLLGSFHIHYMLLAGDWDFWIDFKDRRMWPTVTPIVAMCFAAAAQSFFWTRFRLPI 94  Methylocystis sp. SC2
Q70EF3    13 FNSVAEAAGCVQTVDWMLLVLLFFAVLGGYHVHFMLTAGDWDFWVDWKDRRMWPTVVPILGVTFCAAAQAFWWVNFRLPF 92  Methylocystis sp. SC2
EIC29219  11 kpySGEKARLVRAYDYLILVLALFLFIGSFHLHFALTVGDWDFWVDWKDRQWWPLVTPLMGITFPAAVQAVLWDKFRLPL 90 
1YEW_J    88 GATVCVLGLLLGEWINRYFNFWGWTYFPINFVFPASLVPGAIILDTVLMLSGSYLFTAIVGAMGWGLIFYPGNWPIIAPL 167 Methylococcus capsu...
Q3J891    88 GATLVTLGVLAGEWANRYFNFVGFTYFPINFVWPTILLPMALFLDAMLAISKSYGLTAVVGGLMYGLLMYPANWPLLSAF 167 Nitrosococcus ocean...
Q2YAW5    91 GATLCIVCLLVGEWLTRFWGFYWWSHYPMNFVFPSTMIPGALVMDTVLLLTRNWMITALVGGGAFGLLFYPGNWTIFGPT 170 Nitrosospira multif...
6CXH_B    88 GATLCVLGLLLGEWINRYFNFWGWTYFPVNFVFPSNLMPGAIVLDVILMLSNSMTLTAVVGGLAWGLLFYPGNWPIIAPL 167 Methylotuvimicrobiu...
Q6MZ17    95 GATTVVLALLIGEWINRYDNFWGWTFFPINLVFPSALIPMGFWLDIVLMISGSWLVTALLGGLGWGLLFYPINWPVLAQY 174 Methylocystis sp. SC2
Q70EF3    93 GAVFAALGLLIGEWINRYVNFWGWTYFPISLVFPSALIVPAIWLDVILLLSGSYVITAIVGSLGWGLLFYPNNWPAIAAF 172 Methylocystis sp. SC2
EIC29219  91 GATLCVAALLIGTWVTRIFAYHYWNYFPVNMVLPATMLPGALVLDAILMLSNSFTITAIIGGSAFALLFYPSNWPIFALF 170
1YEW_J   168 HVPVEYNGMLMSIADIQGYNYVRTGTPEYIRMVEKGTLRTFGKDVAPVSAFFSAFMSILIYFMWHFIGRWFSNE-RFLQ 245 Methylococcus capsul...
Q3J891   168 HVPAEYNGVVMSLADIMGYQYVRTGTPEYIRMIEKGTLRTFGKDVVPVSAFFSGFVAMVMYFVWHFVGRWFSKD-YHID 245 Nitrosococcus oceani...
Q2YAW5   171 HLPLVAEGVLLSVADYTGFLYVRTGTPEYVRLIEQGSLRTFGGHTTVIASFFSAFVSMLMFTVWWYFGKVYCTAfYYVK 249 Nitrosospira multifo...
6CXH_B   168 HVPVEYNGMMMTLADLQGYHYVRTGTPEYIRMVEKGTLRTFGKDVAPVSAFFSGFVSILIYFLWHFFGSWFGSE-KFVQ 245 Methylotuvimicrobium...
Q6MZ17   175 HQAAEIDGVLLTLADLIGFNYVRTGTPEYIRMVERGTLRTFGKDVVPVAAFFSGFISMLVYFLWWNMGKWFSTT-KYLE 252 Methylocystis sp. SC2
Q70EF3   173 HQATEQHGQLMTLADLIGFHFVRTSMPEYIRMVERGTLRTFGKDVVPVAAFFSGFVSMMVYFLWWFMGRWYSTT-KIID 250 Methylocystis sp. SC2
EIC29219 171 HMPVEYANAQLTLADLFGFQYIRTGMPEYLRIIERGTLRTYGQYAAPLAAFCSALLCTLMYALWWYIGKWFATT-RYLN 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap