Conserved Protein Domain Family
L71

?
pfam02448: L71 
L71 family
This family of insect proteins are each about 100 amino acids long and have 6 conserved cysteine residues. They all have a predicted signal peptide and are probably excreted. The function of the proteins is unknown.
Statistics
?
PSSM-Id: 426778
Aligned: 26 rows
Threshold Bit Score: 60.0822
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VUS6               26 ICRQENETCRRNERRLGVQNDVSTTFNNHCRRQSgiRNWRNVSRCELSLATCRLTLERCAVINCKNVRN 94  fruit fly
XP_002030623         25 ICRRIVDRCESRVARNGRNNDISNIFNENCRRTH--RNWREISRCELAKANCILTLERCDTLSCENVRR 91  Drosophila sechellia
WGS:AAPP:GF24086-PA  26 VCQRVNARCLRSARNHGPNNDISNIFNDWCRRQH--RNWRNISRCELVRATCRLTLERCRSLSCDNVRE 92  Drosophila ananassae
WGS:AAPU:GI13624-PA  28 ICEKLNRDCVACQRRRGPDDDVTNIFNANCRRSD--RRWKNITRCELDRATCELTLGSCRAVTCANVRR 94  Drosophila mojavensis
XP_002065910         27 LCERQNRICQSNERRLGRRDDVTDAFNARCRRDN--SRWRNISRCELARASCQ----------CKILtn 83  Drosophila willistoni
Q2M1E3               18 FCDGLVAECRRHEREVGPRDDTVDIYNQHCARID--RTWRRITRCQLVHASCLLTILRCDNLTCKNVAG 84  Drosophila pseudoob...
XP_001957358         28 FCDRLTAECVRHERQVGTVDDTVTIYNNHCRRAD--RNWRNITRCELVRASCILTMVRCDNPTCKNVAD 94  Drosophila ananassae
Q9VUT0               28 FCDRLFANCLREQPTVGTRDDTVDLFNSYCGRNN--RNWRKLTRCELVKASCIVTMVRCENGSCKNVAD 94  fruit fly
XP_002030628         28 FCDRLFADCLREEPYVGRRDDTVDLFNLYCFQNVfrGHWMNVSRCQLVKASCILTMVRCDNLSCKNVfl 96  Drosophila sechellia
EDW35220             26 ICQRENAKCLRNENRLGSTNDVTAAFNSQCRRTN--RRWRNITRCQLANATCQLTLVRCQTLSCDNVLR 92  Drosophila persimilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap