Conserved Protein Domain Family
MerT

?
pfam02411: MerT 
MerT mercuric transport protein
MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerE).
Statistics
?
PSSM-Id: 111318
View PSSM: pfam02411
Aligned: 3 rows
Threshold Bit Score: 170.821
Threshold Setting Gi: 75342506
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O54317         1 MSEpKTVRGALFAGGLAAMLASTCCLGPLILVTLGISGAWIGNLAALEPYRPFFIAAALVALFFAWRRIYRPVHAYTQGA 80  Thiobacillus sp.
Q54462         1 MSK-SNPNFPIIGGVIAAIGAGLCCAGPFVLLLLGVSGSWIGNLTLLEPYRPIFILLVLALFGFAGWKVYRPVEDCEPGT 79  Shewanella putr...
WP_001294659   1 MSEpQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWRRIVRPTAACKPGE 80  Gammaproteobact...
O54317        81 VCSMPQVRRTYKPVFWIVVALILVAIAFPYVLRLFY 116 Thiobacillus sp.
Q54462        80 SCAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA 115 Shewanella putrefaciens
WP_001294659  81 VCAIPQVRTTYKLIFWFVAVLVLVALGFPYVMPFFY 116 Gammaproteobacteria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap