4WCW,6SJ6,3UPS


Conserved Protein Domain Family
RsfS

?
pfam02410: RsfS 
Click on image for an interactive view with Cn3D
Ribosomal silencing factor during starvation
This family is expressed by almost all bacterial and eukaryotic genomes but not by archaea. Its function is to down-regulate protein synthesis under conditions of nutrient shortage, and it does this by binding to protein L14 of the large ribosomal subunit, thus acting as a ribosomal silencing factor (RsfS) by blocking the joining of the ribosomal subunits. This family is structurally homologous to nucleotidyltransferases.
Statistics
?
PSSM-Id: 460550
Aligned: 786 rows
Threshold Bit Score: 39.7328
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WCW_B        12 RVAAGAAAAKLADDVVVIDVSGqLVITDCFVIASGSNERQVNAI---VDEVEEKMRQAGY------RPa-----rREGAR 77  Mycobacterium t...
CCD79642      93 pELMKALERENIRDIVCLNVNC-NFLAPYMVIGSGLSKRHIQNT---AVHIHKLLKYKLRdt--siPLp-----lFQGID 161
XP_010711069  15 DFVVNLLRQENAKDICVIQVPPeIKYCNYFIVVSGSSTRHLHAM---AHYMLKMYKHQKEen---dPHt-----rIEGK- 82 
XP_016161718  67 DLVVALLRQENAKDICVIQLSPeMKYCDYFIIVSGFSTRHLHAM---ANYMLKMYKHLKEeg---rANt-----qIEGK- 134
XP_026270600  93 DMLVSLLRQENARDICVIKVPPeMRYTDYFVIGSGTSTRHLHAM---AYYIVKMYK--HL------KRksepyvkIEGK- 160
XP_007505438  81 DLLVSLLRQENARDICVIWVSPaLKYVDYFVVASGASPRHLQAM---AQYLLKTHKFLRSpr---eAFa-----rIEGK- 148
NP_001313544  82 pLLVSALRQENATDICVIRVAPeLKYTDYMIIVSGASPRHLSAM---AAFLIKVFKTLRKde---eRHv-----rLEGS- 149
XP_020565796  97 DVLVSLLRQENAVDLCVIKVPEnIKYAEYFIVVSGISPRHLRAMalyAIKVYKFLRKDgdp-----------nvkIEGK- 164
EEC12594      85 EELVEVLRDEKLTDIAVIAVPEeMVYTDYLVLCTAVSPRHSRGM---FVSLFTQYKRKKDkt---dPTl-----fIEGE- 152
EGF83920     276 SHVLKVIADERGFNLTVIDVRSkCDHTDYMVIVEGRSTKQIYSI---ADAVRRKVKSVTPvngsmpDHl-----qIQGA- 346
4WCW_B        78 EG-RWTLLDYRDIVVHIQHQDDRNFAALDRLW 108 Mycobacterium tuberculosis H37Rv
CCD79642     162 GScEWIAVDMNTIFLHLFLPATRLKYDLESLW 193
XP_010711069  83 ETdDWLCIDFGSIVVHFMLPETRETYELEKLW 114
XP_016161718 135 ETeDWLCIDFGNIVVHFMLPETREVYELEKLW 166
XP_026270600 161 DTdDWLCVDFGSMVIHLMLPETRETYELEKLW 192
XP_007505438 149 DSeDWLCVDFGCMVVHLMLPGTRETYELEKLW 180
NP_001313544 150 DCdDWKCIDFGSVVVHLMLRDCRDQFELEKLW 181
XP_020565796 165 DAeDWMCIDFGKIVVHFMLPETREVYELEKLW 196
EEC12594     153 QCpEWKVLDMGNVVLHIFLPEAREHYDIETLW 184
EGF83920     347 DSeDWMALDLGNVILNCFTPESRQFYDLDRLW 378
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap