Conserved Protein Domain Family
ELH

?
pfam02323: ELH 
Egg-laying hormone precursor
This family consists of egg-laying hormone (ELH) precursor and atrial gland peptides form little and California sea hare. The family also includes ovulation prohormone precursor from great pond snail. This family thus represents a conserved gastropoda ovulation and egg production prohormone. Note that many of the proteins present are further cleaved to give individual peptides. Neuropeptidergic bag cells of the marine mollusk Aplysia californica synthesize an egg-laying hormone (ELH) precursor protein which is cleaved to generate several bioactive peptides including ELH, bag cell peptides (BCP) and acidic peptide (AP).
Statistics
?
PSSM-Id: 145463
View PSSM: pfam02323
Aligned: 4 rows
Threshold Bit Score: 280.519
Threshold Setting Gi: 74833601
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O96843  87 MKRPNNRPTNTMS-LILCLTLSSLCVSSQSASVHGKNFATNRAVKsSSPFVVLSPDDnvvsmSGENgyrsalrEAFDKSS 165 sea hare
P17685   1 MGRPSYRSAAAIS-LLMCLILSALCASSESAVVHGSSFATERAVK-SSPYLVLSPADemvgmSTAN-------EAFDKSP 71  little sea hare
P06308   7 LSKPDYGVVGIVFtVVFCCWCSSSTTHALSIAEPGRDRYDKRSPTgHGVEVVESGED-----YGSNrpqpvygDEDEEDS 81  great pond snail
O16847   1 MK------ANTMF-IILCLSLSTLCVSSQSTSVHGKIFVPNRAVK----------------------------------- 38  California sea hare
O96843 166 RDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAvyQRDLRAPRLRFYSLR 245 sea hare
P17685  72 SYYDDDDDDFVKNEKRRLRFHKRRIRFNKRPQEVSGLKPVMMSRASASADENSLFDLYNTDGAmyQRDLRAPRLRFYSLR 151 little sea hare
P06308  82 ADVYVGSDESSSGEKTRLTAAKRRLRFNKRRLRASKRRLRFHKRRVDSADE------SNDDGF--DRKAREPRLRFHDVR 153 great pond snail
O16847  39 ----------------------------------------------LSSDGNYPFDLSKEDGA--QPYFMTPRLRFYPIG 70  California sea hare
O96843 246 KRAAGGMEQSEGQNPETESH---SRRKRSVLT-PSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLR 321 sea hare
P17685 152 KRAAGDEDKSEENNPETESH---SRRKRSALT-PSIRSLRSSLESGIAKRISINQDLKAIADMLIVEQKQEREKYLADLR 227 little sea hare
P06308 154 KRSATAEEGSENAEIE-ESHlgnSRSRRSAGSaPS-----SANEVQRSKRLSITNDLRAIADSYLYDQHKLRERQEENLR 227 great pond snail
O16847  71 KRAAGEMEQSEGQNPETKSH---SWRKRSVLT-PSLSSLGESLESGISKRISINQDLKAITDMLLTEQIQARRRCLAALR 146 California sea hare
O96843 322 QRLLEKGKRSSG----VSLLTSNKDEEQREL 348 sea hare
P17685 228 QRLLNKGKRSSE----VALAASDKGDEEREL 254 little sea hare
P06308 228 RRFLELGKRGSAffdhIPIIFGEPQYDYQPF 258 great pond snail
O16847 147 QRLLDLGKRDSD----VSLFNGDLLPNGRCS 173 California sea hare
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap