Conserved Protein Domain Family
Fumarate_red_C

?
pfam02300: Fumarate_red_C 
Fumarate reductase subunit C
Fumarate reductase is a membrane-bound flavoenzyme consisting of four subunits, A-B. A and B comprise the membrane-extrinsic catalytic domain and C and D link the catalytic centers to the electron-transport chain. This family consists of the 15kD hydrophobic subunit C.
Statistics
?
PSSM-Id: 426709
Aligned: 31 rows
Threshold Bit Score: 108.485
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44892                   3 KRKKYVRPMTaTWWQKLDFYKAYMLREATSVFAVWFCIVLLYGVLCFASNpmpGLGILSFIEFLRNPIVVFLNIITLIAT 82  Haemo...
WP_011814237             3 RPHAYRPTMR-GWWQRHPAYRRYLLREGSSVLLALYAIWLLIGVLCLAAG---EAAYEGWRALHGHPWLFGLHLAALLAA 78  Halor...
PRJNA210423:M911_06900   3 QPRTYTRGMQ-RWWLRRPSYRFYLLREGTSVVIALYGLFLLAGMAALAVG---PGAFETWRGLLFSPLSWLLHLVVLAAF 78  Ectot...
jgi:Rvan_3008            3 ERRPYMRPMPrDWWAHRP-FRHYTIRELSGVTIAVYAAVLLSGLVALLRG---LEAWDAWRGWLASPASLVLHGALLIAM 78  Rhodo...
jgi:Msil_1723            3 ESRPFHRPRPsRWWAHKP-YRAYTIRELCGVAVAVYGAILLAGVVCLWRG---PDAYDAYRRALASPWSLLAHLLLLAAV 78  Methy...
BAL95467                 7 tlKTYQRPMA-GWWTKNPFYVLYMIREGSAVLLAAYALVLLVGLARLAQG---EAEYEAWRAALASPLAIVFHLVAAALV 82  Rubri...
WP_009548822             2 SRRPYKRPMG-RWWQRDPFFVRYMWREATALAVGAYAVLLLAGLWRLGQG---EAAWTAWLGWLHSPLAWLLHAVLLAGM 77  Burkh...
WP_015434185             6 pRRPYMRPMT-GWWRRNPFFVEYMIHEGTALFVAAYAIVLLVGLLRLAQG---EAAWNGWLDALRSPLSVAFHVVLLAAI 81  Azoar...
Q7NSQ3                   3 KRKPYVRPME-GWWKKNPYFIEYMIHEGTALFVAAYGFVLLFGLWRLSQG---EAAWNGFVAALRSPLSMLLHLILLAMI 78  Chrom...
P9WNB7                   1 -msAYRQPVErYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAG---GNSYQRFLDFSANPVVVVLNVVALSFL 76  Mycob...
P44892                  83 LYHTVTYFLMTPKVM-NIIVKN--ERLPHTVVRNALWAVTALVS 123 Haemophilus influenzae Rd KW20
WP_011814237            79 IFHAVTWFRLLPLTLpVLRWRG--YRPTDRMLVWGGWVLSAVLS 120 Halorhodospira halophila
PRJNA210423:M911_06900  79 TFHAWTWFKVLPLTVpPVKTRRfpRGFTDATLNRVALWAWGVVS 122 Ectothiorhodospira haloalkaliphila
jgi:Rvan_3008           79 LWHVRTWFQILPKTMpKLILGG--TPVPQRTITLVGTSVAVVCS 120 Rhodomicrobium vannielii ATCC 17100
jgi:Msil_1723           79 LWHVVTWFQILPKTMpKLVLRG--RLVPQRLLSAVTLSIACACS 120 Methylocella silvestris BL2
BAL95467                83 AYHSFTWFGVMPKTApKL-------PFPPRLVTVGGWIAALVVS 119 Rubrivivax gelatinosus IL144
WP_009548822            78 VFHAITWMQVLPKTLpLLFAGG--QRVPDVTIVRIGFGAALAAN 119 Burkholderiales bacterium JOSHI_001
WP_015434185            82 GYHAWTWFRIMPKTMpPLVIGG--HRLRPGEITAAGIGAAILAS 123 Azoarcus sp. KH32C
Q7NSQ3                  79 GYHGYTWFKIMPRTLpPLIIGG--RRVSATAITAGGFAATLLAS 120 Chromobacterium violaceum
P9WNB7                  77 LLHAVTWFGSAPRAM-VIQVRG--RRVPARAVLAGHYAAWLVVS 117 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap