1KY6


Conserved Protein Domain Family
Alpha_adaptin_C

?
pfam02296: Alpha_adaptin_C 
Click on image for an interactive view with Cn3D
Alpha adaptin AP2, C-terminal domain
Alpha adaptin is a hetero tetramer which regulates clathrin-bud formation. The carboxyl-terminal appendage of the alpha subunit regulates translocation of endocytic accessory proteins to the bud site.
Statistics
?
PSSM-Id: 426707
Aligned: 19 rows
Threshold Bit Score: 128.987
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KY6_A        134 FFQPTEMASQDFFQRWKQLSNPQQEVQNIFK----AKHPMDTEITKAKI-IGFGSALLEEVDPNPANFVGAGIIHTKTT- 207 
Q5KEF7        937 FAEGVHLESGPFFERWKIIGGPPREAQQIFPikltANGMVDIGRNQRVI-TGNKLSVLPDIDHKPENIVFAGVLHMSSAg 1015 Cryptococcus ...
KIS71472      864 FVEPVQLGANDFFERWRQIGGAPREAQKIFSfklsAAGQVDVARQRRIL-EGARMQVLEGVDANATNSVAAGVLHMADAg 942 
Q86KI1        872 FFEPLRLSSGDFFARWKTISGKPLEIQEIFK----STKPIDIQSYNRVIqEGLNITVLKQVDPNPNNIVASCLFPFGSNg 947  Dictyostelium...
CAF90949      572 FFQPTEMTSHDFFQRWKQLSQTQQEAQKIFK----ANNSMDTEVLKAKL-LGLGTALLENIDPNPENYVCAGVIQTK-Sq 645 
Q0VCK5        825 FFQPTEMASQDFFQRWKQLSNPQQEVQSIFK----AKHPMDTEVTKAKI-IGFGSALLEEVDPNPANFVGAGIIHTR-Ta 898  cattle
P17426        864 FFQPTEMAAQDFFQRWKQLSLPLQEAQKIFK----ANHPMDAEVTKAKL-LGFGSALLDNVDPNPENFVGAGIIQTK-Al 937  house mouse
XP_001641214  829 FFTSVEMNSQDFFTRWKGLSSPQQECQKIFQ----AKYPMESGTIATKL-SGFGLAIQNGVDPNPENFVCAGIIKMKVAg 903 
P91926        827 FFEPTEMNAESFFARWKNLSGEQQRSQKVFK----AAQPLDLPGARNKL-MGFGMQLLDQVDPNPDNMVCAGIIHTQ-Sq 900  fruit fly
CAP34239      812 FFEPTSMTSEQFFNRWKSLGAASQEAQKIFA----AQSPMETATIETKL-KGFGANLLTEVDPNPDNYVCAGIIHTQ-Tq 885 
1KY6_A        208 Q-IGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCE 241 
Q5KEF7       1016 K-VGILGRVEPNKDAKLCRLTVRSTNEHVSAEILS 1049 Cryptococcus neoformans
KIS71472      943 K-VGCLLRLEPNKDAKLARLTVRTTNDLASAEMLR 976 
Q86KI1        948 QpINSYIRIETNPQANMCRLTIRSQSATLTNTIKN 982  Dictyostelium discoideum
CAF90949      646 Q-IGCLLRLEPNAQAQMYRLTLRCSKDSVSKRLCE 679 
Q0VCK5        899 Q-IGCLLRLEPNLQAQMYRLTLRTSRETVSQRLCE 932  cattle
P17426        938 Q-VGCLLRLEPNAQAQMYRLTLRTSKEPVSRHLCE 971  house mouse
XP_001641214  904 Q-VGCLLRLEPNRQAKMYRLTLRSSRPEVATHLCE 937 
P91926        901 Q-VGCLMRLEPNKQAQMFRLTVRASKETVTREICD 934  fruit fly
CAP34239      886 Q-IGTLIRLEPNKQAKMYRLTIRSSKDTVVQTLVD 919 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap