1IWP,1DIO


Conserved Protein Domain Family
Dehydratase_SU

?
pfam02287: Dehydratase_SU 
Click on image for an interactive view with Cn3D
Dehydratase small subunit
This family contains the small subunit of the trimeric diol dehydratases and glycerol dehydratases. These enzymes are produced by some enterobacteria in response to growth substances.
Statistics
?
PSSM-Id: 426701
Aligned: 33 rows
Threshold Bit Score: 168.179
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IWP_G           6 MRVQDYPLATRCPEHILTPTGKPLTDITLEKVLSGEVGPQDVRISRQTLEYQAQIAEQMQRHAVARNFRRAAELIAIPDE 85 
EGN38311         1 ---mQYPLGEHEKERITSKTGMKLTDITLDEVMKNHISADDIKISREMLKAQGQVAKEAGNDPMEKNFERAAELVDVPDE 77 
CDA04848         1 --msSYPLGQNEADTITSKTGKKLSDITLDEVKRGNVQAEDIKISPEMLKRQGQVAKEADNPQMEANFQRASELANVPDE 78 
WP_006299595    39 VTAADYPLGSKRPDLLKSPRGIPFQELTLEAVESGKATFEDFRITPDALEMQARIAESAGRPQIARNLRRAAELTRVPDE 118 Aminomonas pa...
jgi:Tlie_0198   42 LKVEDYPLASKRPELLKTPTGKAIEDVNLDNLLSGKVGFEDLRITPEALEYQAQIAEAAGKEQVAMNLRRSAELIKVPDK 121
jgi:Toce_0551   36 dpKLDFPLSKKRPELLKSATGKKFTEITFEEALRGNVRAEDFRISPDTLLIQAEIAERVGRKQFANNLRRAAELTRVPDE 115
jgi:Ilyop_1292   9 npISDYPLGEKRKEWLKTSTGKTLDEITLENVINGDIKPEDIRISPETLKLQGEIAKKGNRPTITKNFERASEMVAIPDD 88 
KRK52066        37 MTADDYPLYQKHRDLVKTPKGHNLDDINLQKVVNNQVDPKELRITPEALKLQGEIAANAGRPAIQKNLQRAAELTRVPDE 116
WP_014215800    39 LTAKDYPLYSKHPELVHSPSGKSLDEITIDNLLSEKVKSNDLRITTDTLRLQGEVAADAGRSAVQRNLQRAAELTKIPDD 118 Pediococcus c...
WP_013949390     6 LSVADYPLAERRPDIVETKTGKTLEDISLDAVLTDKVGLEDLRITDRALRQQAEVAKAAGRPTLAANFRRGAELVDVPQD 85  Hyphomicrobiu...
1IWP_G          86 RILAIYNALRPFRS-SQAELLAIADELEHTWHATVNAAFVRESAEVYQQRHK 136
EGN38311        78 VILKMYDKLRPNRS-TKLELVMMAQELLEKYNAKNCAKLVMEAAEVYEKRGI 128
CDA04848        79 VILNMYNKLRPNRS-TKTELVLMAQELLEKYSAPHCAKLVLEAAEIYEKRGI 129
WP_006299595   119 RILQIYNAMRPHRS-TREEMEAIARELEETYAAKVCAGFVREAAEVYGRRKL 169 Aminomonas paucivorans
jgi:Tlie_0198  122 RLLEIYNALRPRRS-TKQELLDIADELESKYNAVVNARMVREAADVYERRGL 172
jgi:Toce_0551  116 RILEIYNALRPYRS-TKEELLAIADELQQKYDAPICAAFVREAAEVYERRRR 166
jgi:Ilyop_1292  89 KILATYNALRPYRS-SKEELFEIADELESKYSAVVISAFIKEAAEVYEQRGQ 139
KRK52066       117 RVLEMYDALRPFRS-TKQELLNIAKELRDKYDANVCAAWFEEAADYYESRKK 167
WP_014215800   119 RVLEMYNALRPYRS-TKQELFDIATELRDKYNATICAGWFEEAAANYEARKK 169 Pediococcus claussenii
WP_013949390    86 VIMRTYELLRPGRAgSKDELLAAAKELRVVYGANGVAAFIEEAADVYERRSL 137 Hyphomicrobium sp. MC1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap