1THT


Conserved Protein Domain Family
Acyl_transf_2

?
pfam02273: Acyl_transf_2 
Click on image for an interactive view with Cn3D
Acyl transferase
This bacterial family of Acyl transferases (or myristoyl-acp-specific thioesterases) catalyze the first step in the bioluminescent fatty acid reductase system.
Statistics
?
PSSM-Id: 111194
View PSSM: pfam02273
Aligned: 4 rows
Threshold Bit Score: 547.118
Threshold Setting Gi: 150703
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1THT_B     6 KTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVGLSSGSIDEFT 85  Vibrio harveyi
CAQ84605   8 KTIDHVICVEENRKIHVWETLPKENSPKRKNTLIIASGFARRMDHFAGLAEYLSQNGFHVIRYDSLHHVGLSSGTIDEFT 87  Photorhabdus asymbi...
AAA25626   8 VPIDHVIKVDNERHIRVWETFPKNQCDKRNNTIVIASGFARRMDHFAGLAEYLSTNGFHVIRYDSLNHVGLSSGEIDQFS 87  Photobacterium phos...
P21309     8 LPIDHVIDIGDNRYIRVWETKPKNKETKRNNTIVIASGFARRMDHFAGLAEYLANNGFRVIRYDSLNHVGLSSGEIKQFS 87  Photobacterium leio...
1THT_B    86 MTTGKNSLCTVYHWLQ-TKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPND 164 Vibrio harveyi
CAQ84605  88 MSIGKQSLLAVVDWLN-TRKINNLGMLASSLSARIAYASLSEINVSFLITAVGVVNLRYTLERALGFDYLSLPIDELPDN 166 Photorhabdus asymbi...
AAA25626  88 MSVGKKSLLTVIDWLKsEHGIDQVGLIASSLSARIAYDIVADVNLSFLITAVGVVNLRNTLEQALKYDYLQMEIDEIPED 167 Photobacterium phos...
P21309    88 MSVGKHSLLTVIDWLK-ERNINNIGLIASSLSARIAYEVAAEIDLSFLITAVGVVNLRSTLEKALKYDYLQMEVNTIPED 166 Photobacterium leio...
1THT_B   165 LDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLG 244 Vibrio harveyi
CAQ84605 167 LDFEGHKLGAEVFARDCFDSGWEDLTSTINSMMHLDIPFIAFTANNDDWVKQDEVITLLSSIRSHQCKIYSLLGSSHDLG 246 Photorhabdus asymbi...
AAA25626 168 LDFDGYNLGSKVFVTDCFENNWDTLDSTINKTKNLNVPFIAFVANDDSWVQQHEVEELMSNINSDKTKIYSLIGSSHDLG 247 Photobacterium phos...
P21309   167 LIFEGHNLGSKVFVTDCFENNWDSLDSTINKICELDIPFIAFTSDGDDWVCQHEVKHLVSNVKSDKKKIYSLVGSSHDLG 246 Photobacterium leio...
1THT_B   245 ENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIEN 299 Vibrio harveyi
CAQ84605 247 ENLVVLRNFYQSVTKAAIAMDNGCLDIDVDIIEPSFEHLTIAAVNERRMKIEIEN 301 Photorhabdus asymbiotica
AAA25626 248 ENLIVLRNFYQSITKAAIALDSNLVGLVSEIIEPQFEALTIATVNERRLKNKIQS 302 Photobacterium phosphoreum
P21309   247 ENLVVLRNFYQSMTKAAVSLDRQLVELVDEIIEPNFEDLTVITVNERRLKNKIEN 301 Photobacterium leiognathi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap