3OUG


Conserved Protein Domain Family
Asp_decarbox

?
pfam02261: Asp_decarbox 
Click on image for an interactive view with Cn3D
Aspartate decarboxylase
Decarboxylation of aspartate is the major route of beta-alanine production in bacteria, and is catalyzed by the enzyme aspartate decarboxylase EC:4.1.1.11 which requires a pyruvoyl group for its activity. It is synthesized initially as a proenzyme which is then proteolytically cleaved to an alpha (C-terminal) and beta (N-terminal) subunit and a pyruvoyl group. This family contains both chains of aspartate decarboxylase.
Statistics
?
PSSM-Id: 426684
Aligned: 332 rows
Threshold Bit Score: 129.784
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OUG_F            6 ISVLKSKISYATVTGKDLFYVGSITIDSEIXKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIG 85  Francisella ...
jgi:Fluta_0498    2 INLLKSKIQELVVSESSLDYPGSISLPIELIRMANLTEFEQVFVNNKTSGARISTYVVLS-KQNGFVSLNGAASHHFKKG 80  Fluviicola t...
UCNUF:IALB_0059   3 LTLLKSKIHRATVTGADINYEGSIAIDKNLINAANLNLFERVEIYNISNGERFATYVIEGKE--GEISLNGAAARLVHIG 80  Ignavibacter...
WP_014856464      3 RTLLKSKLHRAVVTSADLNYEGSISIDRELCELADIKEFEKVDIYNINNGERFSTYVIYG--GKGEIGLNGAAARLAQPG 80  Melioribacte...
jgi:Thal_0687     3 RRMLKSKIHRARITGCELHYEGSIAIDESLLRASNILPFEQVDVYNVNNGARFSTYVIPAPPGSGEVRLNGAAARLGMPG 82  Thermocrinis...
WP_012963311      3 RFVLKSKIHRLKITGKELHYEGSLSLDSALMESANLVPFEKIDVYNVNNGARFSTYVIPAPTGSGEVRLNGAASRLGEVG 82  Hydrogenobac...
O66773            3 REMLKSKIHRLTVTDADLHYEGSLSLDEYLMELADLKPFEKIDVYNINNGARFQTYVIPAPRYSGEVKLNGAAARLGHKG 82  Aquifex aeol...
C0QRI3            3 RTILKSKIHRITITGADLHYEGSLTLDEAIMEAANLVPFEKIEIYNVNNGHRFSTYVIPGQRYGGECILNGAAARLGHAG 82  Persephonell...
jgi:TOPB45_0204   3 IKLLKSKIHLATVTGKNLFYEGSLTLDKEIMEKANLKPFEAVWIYNLNNGKRFETYLLEG--NKGEVVLNGAAARLGEIG 80  Thermodesulf...
WP_013906927      3 RKFLRSKLHTVRVTAKNLEYEGSLTLDPRFMIAAGLEPFESIWVYNLENGERFETYVIKGEWGSKEVCLNGAAARKGEVG 82  Thermodesulf...
3OUG_F           86 DQLFIISYTQVDPTR-E--NIKPKLVDLK 111 Francisella tularensis subsp. tularensis SCHU S4
jgi:Fluta_0498   81 DIIHVLSYRMVDEAEa--pRFRPTLVRAN 107 Fluviicola taffensis DSM 16823
UCNUF:IALB_0059  81 DLIIVASYCQLDENEvR--NHKPIIILVD 107 Ignavibacterium album JCM 16511
WP_014856464     81 DLIIIASYAVYDESEtN--NFKPKILLLD 107 Melioribacter roseus
jgi:Thal_0687    83 DIVIIASYCMVDEVSlQlgTFRPVMVYVN 111 Thermocrinis albus DSM 14484
WP_012963311     83 DIIIIASYALMEERElD--SFKPVLVYVN 109 Hydrogenobacter thermophilus
O66773           83 DLIIIASYAQYTEEElE--NYAPKLIFVN 109 Aquifex aeolicus VF5
C0QRI3           83 DIIIIVSWADLDEEElK--NFKVNLVYMD 109 Persephonella marina EX-H1
jgi:TOPB45_0204  81 DKIIIVSYAWVTEEEiR--NFKTYLVYLT 107 Thermodesulfobacterium geofontis OPF15
WP_013906927     83 DRLIVVSYHWLRPEEiE--RASVRLVYVD 109 Thermodesulfatator indicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap