7DR6,7DR6,6DFK


Conserved Protein Domain Family
PA28_beta

?
pfam02252: PA28_beta 
Click on image for an interactive view with Cn3D
Proteasome activator pa28 beta subunit
PA28 activator complex (also known as 11s regulator of 20S proteasome) is a ring shaped hexameric structure of alternating alpha and beta subunits. This family represents the beta subunit. The activator complex binds to the 20S proteasome ana simulates peptidase activity in and ATP-independent manner.
Statistics
?
PSSM-Id: 426677
Aligned: 60 rows
Threshold Bit Score: 178.855
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7DR6_B              103 PVNCNEKIV-VLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSER 181
EKM61400            113 QMVANQHIQ-KVHGILKKECEELADSIDKVKLWINLSMPKIEDGDNFGVQIQEEVLNELHRSQESAYNLRDAARQSHFNR 191 Phaneroc...
EPT01604            126 LVTANQYVD-KVHAIVKKECEQLADSCDKVKLWVNLSMPKIEDGDNFGVQIQEEVLTELHRSQESAYNIRDAGRQDHLHR 204 Fomitops...
EGO02578            104 LVHANAHII-KLNADIKKECTQLADLCEKVKLWVNLTMPKSNFRHFLGVQIQEEVLTELHRSQESAYNLRDGIRQDYLAR 182 Serpula ...
XP_007842595         98 LVKSNFHAK-SLHDVVKKECEEIATLIDHIKLWVTLRMPRIEDGDNFGVQVQEEALAELHRAQESAYNIRDVPRQDYLSR 176 Moniliop...
XP_003038805         98 SVAANQRLL-GLHDVIKRECEQLGTLVEQVKLWITLTMPKIEDGDNFGVEIQTEVLNELDRVHQSAYNLRDLARQHHLER 176 Schizoph...
XP_001883313         45 LVYDNPRIQ-KIHEVISKQVEEMMLLSEQVEVWIILTIPQIEDGDNFGVQVQEKVLDQILIADKSATIFRSAALDHHLDH 123 Laccaria...
XP_003331090        110 HVASNPKVN-AHFIFLRTHWEELINITNAIKIHINLLIPKIEDGDTFGVQVQEECLSELSRAQDSGYNLLEAQLKHNMSR 188 Puccinia...
KIS72303            117 VVHTPAFLM-RAFDELRIEWDQLIETMDSLKIYINLQMPQIEDGDTFGVSIQEEALNEIIRTQESAYTLISTPFTYHSTR 195 Ustilago...
WGS:AACS:CC1G_01791 109 HVKANDHMTnKIYNFVKKECEELADLTDQVRLWVTLTLPKIEDGDNFGVHVQEEVLGELQRAQESALAIRDLPRQDHLTR 188 Coprinop...
7DR6_B              182 GDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGM 247
EKM61400            192 AKLCSKILKYPHIEDYLLALKEHDEKQLYVAKQNLYDIRNVYAILTDILHKNIGKLRTPKGNNATG 257 Phanerochaete carnosa ...
EPT01604            205 AKICSKIVKYPHLEDYALALKEHDEKQIYVARQNLFDLRNVYAILTDILHKNIAKIRSPKGNNLSG 270 Fomitopsis pinicola FP...
EGO02578            183 AKICSKVIKYPHVEDYTLALKEQDEKQLYLARQHIVDIRNVYAILTDIIHKNINKICSPKGNNGVG 248 Serpula lacrymans var....
XP_007842595        177 AKICSKLIKYPHVEDYTLALQEHDSKQIYYARQRLYDIRNLYAALTDVLHKNIAKIRAPKANNRTG 242 Moniliophthora roreri ...
XP_003038805        177 AKICSKLIKYPNIEDYTMALREHDEKHVRVARENLTDVRDLYAVMTDLIHKNITKIRAPKANNNSG 242 Schizophyllum commune ...
XP_001883313        124 ARICSKLCKYPNVKDYARALEEHDKRQIYIARERLREIRNEYAILVDVIQKNISKIRVPKANHGGD 189 Laccaria bicolor S238N...
XP_003331090        189 AKLASKLIKYPNVEDYQLALQEHDRKSIFLCRQHLLDLRNIYALLTDLLHKNIVKITKPKGANSDG 254 Puccinia graminis f. s...
KIS72303            196 GDLAAKLVKFPGVQDYEKAILEHDRKTVYRLKMYLTDIRNMYAVVFDIVKKNIGKISKPKSGNQMG 261 Ustilago maydis 521
WGS:AACS:CC1G_01791 189 AKICSKLIKYPNIEDYALALRDHDEKQFYFARQHLYDIRNVYASITDMMQKNISKIRTPKSNNRAA 254 Coprinopsis cinerea ok...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap