Conserved Protein Domain Family
Androgen_recep

?
pfam02166: Androgen_recep 
Androgen receptor
Statistics
?
PSSM-Id: 426632
Aligned: 2 rows
Threshold Bit Score: 570.33
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007507022   6 GLGRVYPRPPAKTFRGAFQNLFQSVREVIQNPGVRHPGAAgGAAPPGARLQHQQQqqqqvpqqpQQQQSSPRQPQAsvqp 85  
XP_005593867   6 GLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAA-SAAPPGASLQQQQQ---------QQQETSPRQQQQ---- 71  
XP_007507022  86 QQAPDDGSPPAPNRGPAGYLALeDDSQpQPSQAQPPAEGCPENGCVPEPGPPAAGGKGLQQTavAVAAPDDDDSAAPSTL 165 
XP_005593867  72 QQQGEDGSPQAHRRGPTGYLVL-DEEQ-QPSQPQSAPECHPERGCVPEPGAAVAAGKGLPQQ--LPAPPDEDDSAAPSTL 147 
XP_007507022 166 SLLGPSFPGLSGCSTDLKDILAEAGTMQLLQQQQQHhhhqqhqhqqqqqqeaAVVADGGGGRAREGAGGSASSKDNYLGG 245 
XP_005593867 148 SLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQE----------------AVSEGSSSGRAREASGAPTSSKDNYLGG 211 
XP_007507022 246 TSTISDSAKELCKAVSVSMGLGVEALEHLSPSEQLRGDCMYAQLLGGPaAAARPAPsCAPLTDCKGSLLDDASAKGADEA 325 
XP_005593867 212 TSTISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPVLGVP-PAVRPTP-CAPLAECKGSLLDDSAGKSTEDT 289 
XP_007507022 326 ADYPAFKGGYAKALDGDGLGCCGGSGGGgggeaaAAGQLEMPSALALYKAGSLDEAAAYQSRDYYNFQLALAGPPPPPPP 405 
XP_005593867 290 AEYSPFKGGYTKGLEGESLGCSGSAAAG------SSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPP 363 
XP_007507022 406 PHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLaHGGGaaaaaaaaaaaaaAAGPGSGSPSaAAAaaaaaaaassssss 485 
XP_005593867 364 PHPHARIKLENPLDYGSAWAAAAAQCRYGDLASL-HGAG-------------AAGPGSGSPS-AAA-------------- 414 
XP_007507022 486 sssSSSWHTLFASEEGQLYGP 506 
XP_005593867 415 ---SSSWHTLFTAEEGQLYGP 432 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap