
Conserved Protein Domain Family

pfam02154: FliM 
Click on image for an interactive view with Cn3D
Flagellar motor switch protein FliM
PSSM-Id: 111086
Aligned: 7 rows
Threshold Bit Score: 257.305
Threshold Setting Gi: 300680950
Created: 19-Apr-2021
Updated: 29-Sep-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
4GC8_A   171 EISIMVVLEIIIGHSRGMMNICYPVISIESILSKM 205 Helicobacter pylori 26695
P23453   196 ETVVVISLNTQIGEISGVINLCIPHIVLEPLIPKL 230 Bacillus subtilis subsp. subtilis str. 168
P74927   195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKL 229 Treponema pallidum subsp. pallidum str. Nichols
Q57511   206 EMIILVTLEVKIGKVEGLMNFCLPYITIEPIVSKL 240 Borreliella burgdorferi B31
P23453   196 ETVVVISLNTQIGEISGVINLCIPHIVLEPLIPKL 230 Bacillus subtilis subsp. subtilis str. 168
P74927   195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKL 229 Treponema pallidum subsp. pallidum str. Nichols
Q57511   206 EMIILVTLEVKIGKVEGLMNFCLPYITIEPIVSKL 240 Borreliella burgdorferi B31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap