1T77,1MI1


Conserved Protein Domain Family
Beach

?
pfam02138: Beach 
Click on image for an interactive view with Cn3D
Beige/BEACH domain
Statistics
?
PSSM-Id: 426617
Aligned: 275 rows
Threshold Bit Score: 174.574
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T77_A         139 RWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESW-- 216  human
XP_011676116    18 AWRLGQMTNFEYLTQLNKLGGRSFNDLMQYPVFPFVLNNYIDEKIDLTTEKCFRDLTKPVAVQNKDRVERYMENYKALle 97   purple sea u...
XP_002113197     1 RWRDGKISNFHYLTQLNKIAGRSFNDLMQYPVFPFVLSNYTETTLDLTCPESFRDLSKPIAAQNEDRAKKYKENYQVEi- 79   Trichoplax a...
XP_015795151  1205 LWREGLMTNFEYLTYLNKISGRSFNDLMQYPVFPFILADYDSTVLNLKSPASFRNLSRPMAVQHKSNEEYYINQYNYLke 1284 two-spotted ...
14_pfamImport    2 QWREGALSNWEYLMLLNQIAGRTYHDLMQYPVFPWVLANYDTRTLDLLAERSFRVLEKPIAVQHRELEKHYINNYNHLr- 80  
EDW50149      1779 QWREGLLTNWEYLMTLNQISGRTYNDLMQYPVFPWVLANYNSEVLDLREGHNFRRLGRPIAVQVEENEKHYISNYTYId- 1857 Drosophila s...
2_pfamImport     2 QWRSGSITNWEYLMRLNGLGGRSYNDLMQYPVLPFVLADYTSKILDLDDPNTFRDLSRPVAVQDKKREHHYINTYNDLk- 80  
EFN65741      2776 LWRSGALTNWEYIICLNKLAGRSYNDLMQYPVFPFVLADYVSDKLDLNDPKIYRNFKRPMAVQDKKNEQHYINNYNYLk- 2854 Florida carp...
XP_002427881  2336 MWREGLITNWEYLTFLNKIAGRTYNDLMQYPVYPFVLSDYTSSTLDLNQKNIYRALEKPMAVQEKKNELHYVNNYNELl- 2414 human body l...
XP_016656580  2684 LWRTRQITNMEYLSILNKMAARSYNDLMQYPVMPFVLASYNTTELDLNQLSTYRDLRRPMAIQNKKKEAHYIQHYNYLk- 2762 pea aphid
1T77_A         217 -EDDQv-----------PKFHYGTHYSTASFVLAWLLRIEPftTYFLNLqGGKFDHADRTFSSISRAWRNSQr-DTSDIK 283  human
XP_011676116    98 eYDKNhrmgeeastlviGPYHYGSHYSNSGTVLQYLVRLPPftQMFLHYqDNHFDLPDRTFHSIQTSWFLSSfqSTTDVK 177  purple sea u...
XP_002113197    80 -YYYHsl--------ldLPYHYGSHYSNSGTVLHFLVRVPPytQMFIDYqDQSFDLPDRTFHSMATTWRLSSyeSTTDVK 150  Trichoplax a...
XP_015795151  1285 eYEKSsyfeds-lfpttGPYHFGSHYSNSGTVLHFLVRLPPftQMFLTYqDNSFDIPDRTFHSMETAWRLASgeSKTDFK 1363 two-spotted ...
14_pfamImport   81 qAESGdpngg---rrkiQPYHYSSHYSNSGTVLHFLVRVLPftSLFLQYqDDSFDIPDRTFHSLQTTWNLASkdSPTDVK 157 
EDW50149      1858 sTNTTmgs------lilKPYHYSSHYSNSGTVLHFLVRVPPftSYFLRYqDNDFDLPDRTFHALNTTWLLASrdSPTDVK 1931 Drosophila s...
2_pfamImport    81 aARREacss----qlsrLPHHYASLYSNSGAVLHYLVRLPPftELFLNYqDNNFDMPDRTFHSLATTWRLITkdSPTDVK 156 
EFN65741      2855 qTLTEglnli---alnqGPFHYGSHYSNSGTVLHFLVRLPPftSMFLCYqDNNFDIPDRTFHALATTWRLTScdSTTDVK 2931 Florida carp...
XP_002427881  2415 -GGVKqat------lnkEPYHYGSHYSNSGTVLHFLVRLPPftKMLLHYqDRNFDLPDRTFHSLHTTWRLASseSTTDVK 2487 human body l...
XP_016656580  2763 -EDIHnf--------gtDPHHYSSHYSNSGTILHFLIRVPPytQMFIKYqDNNFDVPDRSFHSMEITWRLSSdeSTTDLK 2833 pea aphid
1T77_A         284 ELIPEFYylPEMFVNFNNYnlgvMDDg-TvVSDVELPPWAkTS-EEFVHINRLALESEFVSCQLHQWIDLIFGYKQQGPE 361  human
XP_011676116   178 ELIPEFFflPEFLLNNQGYdfgcRQSgeT-VHNVILPPWAkDDaRLFVQIMKQALESTYVTQKLHSWVDLVFGYKQLGQH 256  purple sea u...
XP_002113197   151 ELIPEFYylPDFIKNFEGFdfgkRQTgeK-VNDVCLPPWCeNNaRLFILIHRQALESACVSRSINKWIDLIFGCKQTGKD 229  Trichoplax a...
XP_015795151  1364 ELIPEFFtlPEFLLNQEKFnfgiRQNgeV-VDDVKLPTWCrGDaRLFILIHRQALESDYITQNLHDWIDLVFGYKQTGRA 1442 two-spotted ...
14_pfamImport  158 ELIPEFFtfPEFLENQEGFdfgtRQSgeP-VNHVELPAWCgGSaRLFVLIHRQALEANIVRRQLSHWIDLIFGYKQSGQA 236 
EDW50149      1932 ELIPEFFclPEMFENFERFkfgcRQNgeR-VEDVSLPPWSqRDsRLFVLIHRQALESELVRNQIHNWIDLIFGYKQSGES 2010 Drosophila s...
2_pfamImport   157 ELIPELFylPELFYNNEGLnlgiRQCgeG-IDEVELPPWA-ADaRLFTLLHRQALEAAHVSETLPHWIDLVFGHKQTGPA 234 
EFN65741      2932 ELIPEFFylPEFLLNFEGFnfgvRQNgnK-VGDVELPKWCgGDvRLFILAHRAALESDIVREVLPYWIDLVFGFRQTGKP 3010 Florida carp...
XP_002427881  2488 ELTPEFFflPEFLINSQGFnfgiRQNgeV-VNNVFLPPWCkGDpRKFILIHRQALESNYVTENLPRWIDLVFGFKQTGKA 2566 human body l...
XP_016656580  2834 ELIPEFYylPEMFMNFEQLnfgvKQSgeI-VDSVKLPTWAqNNpRLFVLIQRQLLESEIVSENLPHWIDLIFGYKQTGKA 2912 pea aphid
1T77_A         362 AVRALNVFYYLTYEgavnlnsitdpvlReAVEAQIRSFGQTPSQLLIEPHPP 413  human
XP_011676116   257 AVDAINVFHPATYFgrdtrt-ikdntkRrAVETMIKTYGQTPKQLFTNPHPQ 307  purple sea urchin
XP_002113197   230 AIEAINVFHPSTYKvadmdt-ikdpikRnAYLTMVNTYGQTPLRLFRNPHVE 280  Trichoplax adhaerens
XP_015795151  1443 AVEAINCFHPATYYgvdvsk-iedpvkSkALHTMIRTFGQMPKQLFNTPHPS 1493 two-spotted spider mite
14_pfamImport  237 AIDAINVFHPATYCdftasd-iddpvmKlALETMVKTYGQMPRRLFDTPHPP 287 
EDW50149      2011 AVEAINVFHPATYAvfldse-isdpieReAVKTMVKTYGQMPRQLFKSPHPA 2061 Drosophila sechellia
2_pfamImport   235 ALDAIN-----TYYgfdpda-ledevdRsAACAMVRTYGQVPRRLLRQPHPH 280 
EFN65741      3011 AVEAINVFHPATYYgfdveq-isdsleRqAWETMIRTYGQTPAQLFRTPHPl 3061 Florida carpenter ant
XP_002427881  2567 AVDAINVFHPATYSgfdlea-itdpveRiAWETMVKTYGQTPKQLFKTPHPm 2617 human body louse
XP_016656580  2913 AIDAINVFHPATYYgshiee-tedpvaRsAFKTMISTYGQTPRQLFRFPHPM 2963 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap