Conserved Protein Domain Family
7TM_GPCR_Sra

?
pfam02117: 7TM_GPCR_Sra 
Serpentine type 7TM GPCR chemoreceptor Sra
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Sra is part of the Sra superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 111054
View PSSM: pfam02117
Aligned: 10 rows
Threshold Bit Score: 422.906
Threshold Setting Gi: 44889060
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q20405   6 ANSSKCATEDQMILQTSLLLRINVIIMTIVAIITFILTYKALFILKIRPIFHSSTKILLYTSLLFVNVHAVIFMVIQNTA 85  Caenorhabditis elegans
Q09205   1 MSSQKCASHLEIARLESLNFKISQLIYFVLIITTLFFTFFALKVIQKKCIFQLSTKILLYQNLFSANIHQIFLGITIVER 80  Caenorhabditis elegans
Q09209   1 MSAPNCARKYDIARLSSLNFQISQYVYLSLISLTFIFSYFAVKIVHQKSIFQLSTKILLFHNLVSANLHQLLYLFSALRR 80  Caenorhabditis elegans
Q09206   1 MSLTKCASKLEIDRLISLNFRINQIIVLIPVFITFIFTYYAIKVVQKKSIFELSTKFLLIQNFFSANLHQVLYAIETIRR 80  Caenorhabditis elegans
Q09203   1 MSNITSASAAQIDHASSWNFRFAVFCSQLSIISTFILSVIAVKWIFTKSTFQTSTKIILVFNFVYANIHQFMYAIISLGM 80  Caenorhabditis elegans
Q20411   3 TNNPVCASDAHMEMYSSKLYTSALFLNLIIATTSMILTGFAIQKLFMESIINISTRMFLFCGLMCCSLHQTAYIVLRIQV 82  Caenorhabditis elegans
Q09212   1 MATIACASIIEQQRLRSSNFVIAQYIDLLCIVITFVTTYPAIQLVLNKSLFQWSTKMLILESLFFANLYQIFYGIEAITI 80  Caenorhabditis elegans
Q09210   1 MENLTCASSVEQDRFASLNFIISQSVDLITSFFTYMLSIIAIKMVLKQSIFETSTKILLFLNIFYANLYQIVYSIDVVVI 80  Caenorhabditis elegans
Q09208   1 MSNLSCAAPDVLERLDSFNMKLSQFVDLLAIILAFFASYFAIKIVINQSFFELSTKILLLQNLFYTNLYQISYGIEAIGM 80  Caenorhabditis elegans
Q09204   1 MSNSSCADEDLIIRFDSLNQKAAQFVYLLAIILTFITTYFAVKILFTQSFFEISTKILLVQNLFYANLYQFFHGIEAVRM 80  Caenorhabditis elegans
Q20405  86 LIRSFTLSDKPCEIMRTTLECRFQNHVLIFGIAGVNFNQFGLTVDRLLATIIPQSYSHMGALPGVILSVLVVACSIAAPL 165 Caenorhabditis elegans
Q09205  81 LNIAFFKLNDKCIPLRPETNCQLYLEMFIAGLSGMVYGQTGLLFERACATFIKKYEKRKSLATGIITSIIVLLLSGSTAR 160 Caenorhabditis elegans
Q09209  81 LNLAYFYIDEPCVPLISEADCLPYLKVLVTGISGMIYGQTGLLLERGCATFIKDYDKKTSMFVGIAISIAILFLSLITGK 160 Caenorhabditis elegans
Q09206  81 LHISLFETNQPCIPLKTEFECRLYLEVFVSGVAGMVYGQTGLLLERACATFIKNYEEKKSVRTGLAISVSVLCLSFITSR 160 Caenorhabditis elegans
Q09203  81 AYKGIFLLDETCEWLITEKDCLLYTEVLYVGISGMIYSQTGILIERAFATLYRNYTAKISRLVGIIISTFVLIMSIATYQ 160 Caenorhabditis elegans
Q20411  83 IYQVFFKLSEPCNLYYPAIDCKYVTFSLVAGNTGMIFIQSAMTIDRIFATIFPKLWPKLKYWPGVVLSILMIACNYANVQ 162 Caenorhabditis elegans
Q09212  81 LYKHHFMTSDFCNIMQTESNCAPYLKVILGTTGGMIFAQTGLMIERTCATFLASYRKRKSEIIGFSITIIVFFCSSITGK 160 Caenorhabditis elegans
Q09210  81 LYKHFFMQEEVCSLLILESSCAPFLETLIGTSSGMMYCQTGLLIERFCATFLKTYNGKKTIFVGSFIAIVVMISTTSTGK 160 Caenorhabditis elegans
Q09208  81 LYRGFFMLSEPCSILQSETSCAPYFKVLMIGTSGMIFGQTGLLIERAFATFATTYKTKKSVYIGVCISLIVLVCSTSSGF 160 Caenorhabditis elegans
Q09204  81 LYKSFFMINDPCNFMEPEIECVFYYKIILMGSSGMVYGQTGLLIERLCATFSKDYKKKQSAIKCAVISILVLICSSSTGR 160 Caenorhabditis elegans
Q20405 166 IIAIGDPYDDIVPNCFFFPEHSAPRANIFLVTLSTLVITSIFLNFIIIYANKKLEKgcRTRFYVTQRYQKREALISTRII 245 Caenorhabditis elegans
Q09205 161 IIIWDDPLSEYQLACTSWPSKSRDRSTMFFSICTFISLFNLVISLLIRRHNEKLEY--STPFVVGPRFRKREVIDSTSTI 238 Caenorhabditis elegans
Q09209 161 IIIWDDPLQGYLLSCVSYPSQSVERSRLFASIYTFISSFNLVFSVLLRRYNKKLEY--STPFVVGPRFRKREVIDSTSTI 238 Caenorhabditis elegans
Q09206 161 LIIWDDPLDGYQLTCISFPSDSVDRSSYFQSICTLLALFNLVTSILIWKYNKKFEY--STPFVVGPRFRKREVIDSTSTI 238 Caenorhabditis elegans
Q09203 161 IIISDDPLEGVVLSCFVPAQHSAQRANTFLFIALILTFVNLISSAAVMFYNKRLEY--SIRYKVRERFKKREAIYSTHTI 238 Caenorhabditis elegans
Q20411 163 IIFWGDPLTEYVPTCGQFPSKSVNRFQTFLAIALYMSIAHMVINVIILYINVLQDRqqSKSFNVNQRYQSREALKSSQAI 242 Caenorhabditis elegans
Q09212 161 LFIWDDPLDGMVLGCFILPKNSYKRYNTYFTVCTVLPLFNLGISILLKIYNTKLEY--SSRFEVSARFQKREVIDSTGTV 238 Caenorhabditis elegans
Q09210 161 LVIWDDPLDDAVLACFIFPKKSKARSTIHFYISTVVSLFNLAASVALNKYNKTLEY--QVRFKICARFHKRQVIESTETI 238 Caenorhabditis elegans
Q09208 161 IILWDDPLEGWTIGCFAVSKSVVPRFNLFSILSTVLTLFNLIVSIFIQRYNKRFEF--ETRFKVGARFQKQELIESTGAI 238 Caenorhabditis elegans
Q09204 161 LIVWDDPIDKYNFACYIPPKESYIRANHYFTMCAVLSTINFCISTFILKYNKRCEY--QTRFKVGARFQKQELIESTKAI 238 Caenorhabditis elegans
Q20405 246 SYIAASQFLGLTLYSTMVLTLRLHK--SMIPISIYHNMVWWAYTVPFAAVSLPALLIYRINQVGSNRKRVINRITAKVET 323 Caenorhabditis elegans
Q09205 239 CFLTFFQFIFMFIYSFGVFLLGTIR--EIIGYEQYYFWVVWVYTIPFIAASFPILLIYRIRYSNTNRIMIIKQFTSTKQT 316 Caenorhabditis elegans
Q09209 239 CFLTFVQFIFMFIYSFGIFTLKTIR--SMLTYRQYYFIVVWFYTIPFIAALFPILLVYRIRSSHVSRVTIIKTFTKTKQT 316 Caenorhabditis elegans
Q09206 239 CFLTFVQFIFFLVYSLGFFIIKSIR--EIISYENYYLVAVWLYTPPYIAASFPILIFYRIRSSYANRVLIIKKFTNTKQT 316 Caenorhabditis elegans
Q09203 239 CVVCMAQFVTMLVYSSGVLILRCNM--SNILLTTFYKLITWVYTVQYNALLFPLILIFRIRATKLSRTKKIQDITSANQS 316 Caenorhabditis elegans
Q20411 243 FFLSMSQFFACLIYSVFTKVFLEFQ--LNLSPLQSGLVLALSYTTPYACIAIPSLIIFTFRFIKNQRLRNINELRSQTET 320 Caenorhabditis elegans
Q09212 239 CFLAFSLFILLFIYSVGVGALRHLLheNIISQEDFNLCVVWLYTIPFIAMLLPLLLIYRIRRTRSNRIEMLIEFTKQKQS 318 Caenorhabditis elegans
Q09210 239 CFLNFTQFVFMFIYSSGNSTLKSIR--DYIQPETYNFWVVWCYTVPFIALTFPLLLIYKVKSTRGIRAQKIVQISNTKQT 316 Caenorhabditis elegans
Q09208 239 CFLALSQFLWMFMYSFGILILRIIR--EDILPSTFYFWIAWCYTMPFIALMFPVLLIYRIRKTRARRTEKMKGITTEKQT 316 Caenorhabditis elegans
Q09204 239 CFLTVSQFVAVFLNSFGMIVLVYIQ--ESISHRIFNLLVVWLYAFPIVVLMFPVILVHQIRSSRWRRALKIKVIKNEKQT 316 Caenorhabditis elegans
Q20405 324 QEEHMKSLKELW 335 Caenorhabditis elegans
Q09205 317 QEDHIKQMKNVW 328 Caenorhabditis elegans
Q09209 317 QEEHIKQLKNVW 328 Caenorhabditis elegans
Q09206 317 IEEHIQQMKNAW 328 Caenorhabditis elegans
Q09203 317 QTEHYNQITSAW 328 Caenorhabditis elegans
Q20411 321 GDECMRKIAKIW 332 Caenorhabditis elegans
Q09212 319 QENHISQMKNMW 330 Caenorhabditis elegans
Q09210 317 QDEHINQMKVMW 328 Caenorhabditis elegans
Q09208 317 QDDHIKQINAMW 328 Caenorhabditis elegans
Q09204 317 QDDHMKHMKNMW 328 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap